BLASTX nr result
ID: Akebia24_contig00020406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00020406 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31452.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002273502.1| PREDICTED: GATA transcription factor 9-like ... 62 1e-07 >emb|CBI31452.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 356 MLGPGFLDELELDMCGDIFDQIDDLLNFPIEDVEGGIVGGDCD 484 M+GP F+DE++ CG FD IDDLL FP EDV GG++GGDC+ Sbjct: 1 MIGPNFMDEID---CGSFFDHIDDLLEFPPEDVSGGLMGGDCN 40 >ref|XP_002273502.1| PREDICTED: GATA transcription factor 9-like [Vitis vinifera] Length = 340 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 356 MLGPGFLDELELDMCGDIFDQIDDLLNFPIEDVEGGIVGGDCD 484 M+GP F+DE++ CG FD IDDLL FP EDV GG++GGDC+ Sbjct: 1 MIGPNFMDEID---CGSFFDHIDDLLEFPPEDVSGGLMGGDCN 40