BLASTX nr result
ID: Akebia24_contig00019806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019806 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 91 9e-19 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 90.9 bits (224), Expect(2) = 9e-19 Identities = 45/55 (81%), Positives = 46/55 (83%) Frame = -3 Query: 167 YDHLGLRCHDIVLWKRAGCFL*VRPGFFGVVGEGLTFLTHILSYRHGPTDLFSIG 3 YDHLGLRCHD + AG L VRPGFFGVVGEGLTFLTHI SYRHGPTDLFSIG Sbjct: 101 YDHLGLRCHDYFSME-AGGLLEVRPGFFGVVGEGLTFLTHIHSYRHGPTDLFSIG 154 Score = 28.1 bits (61), Expect(2) = 9e-19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 202 AGRTCDGSPGSNM 164 AGRTCDGSP SN+ Sbjct: 88 AGRTCDGSPRSNI 100