BLASTX nr result
ID: Akebia24_contig00019804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019804 (596 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445748.1| hypothetical protein CICLE_v10017346mg [Citr... 56 9e-06 >ref|XP_006445748.1| hypothetical protein CICLE_v10017346mg [Citrus clementina] gi|568863499|ref|XP_006485182.1| PREDICTED: uncharacterized protein At2g27730, mitochondrial-like [Citrus sinensis] gi|557548359|gb|ESR58988.1| hypothetical protein CICLE_v10017346mg [Citrus clementina] Length = 83 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 468 MAMRSAVRRISVTRLMEGNRRIPRYFSDDRGRIFSEEERA 349 MAMRSA+ R+ VTR ME R RYFSDD+GR+ SEEERA Sbjct: 1 MAMRSALCRLKVTRSMESTRGATRYFSDDKGRVLSEEERA 40