BLASTX nr result
ID: Akebia24_contig00019604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019604 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADM83596.1| adenylate cyclase [Ipomoea nil] 55 8e-06 >gb|ADM83596.1| adenylate cyclase [Ipomoea nil] Length = 205 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 100 MEVEVKLNLPDSASHQKLFELLSPFHLKTHLQQ 2 MEVEVKL LPDSASHQ+L +LSP+HLKTH Q+ Sbjct: 1 MEVEVKLRLPDSASHQRLSTVLSPYHLKTHAQE 33