BLASTX nr result
ID: Akebia24_contig00018904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018904 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007017501.1| Uncharacterized protein TCM_034016 [Theobrom... 57 2e-06 >ref|XP_007017501.1| Uncharacterized protein TCM_034016 [Theobroma cacao] gi|508722829|gb|EOY14726.1| Uncharacterized protein TCM_034016 [Theobroma cacao] Length = 866 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -2 Query: 244 MEQMEHNHEHFIRAIKGGLVVKVLNVDSHKKPAFRFKQIKAIYDSQDA 101 ME H HFI+AIKGGLV K +NVD+H +P +FK+IK I + +DA Sbjct: 1 MELRSSTHLHFIQAIKGGLVAKFINVDTHGRPTLKFKEIKEILNLRDA 48