BLASTX nr result
ID: Akebia24_contig00018866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018866 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea va... 91 2e-16 gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subs... 91 2e-16 gb|AAL59842.1| cysteine protease inhibitor CPI-1 [Brassica olera... 91 2e-16 gb|AGX28139.1| cysteine protease inhibitor, partial [Populus eup... 90 3e-16 ref|XP_002299179.1| cysteine protease inhibitor family protein [... 90 3e-16 gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] 89 5e-16 pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Disp... 89 8e-16 gb|AGX28141.1| cysteine protease inhibitor, partial [Populus eup... 89 8e-16 ref|XP_002884906.1| hypothetical protein ARALYDRAFT_897457 [Arab... 89 8e-16 ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-... 89 8e-16 gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa] 89 8e-16 gb|ACO39793.1| cysteine inhibitor 1 [Populus balsamifera] 88 1e-15 gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera] gi|226... 88 1e-15 gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera] gi|226... 88 1e-15 ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trich... 88 1e-15 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 88 1e-15 ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citr... 88 1e-15 gb|ABG89856.1| cystatin [Amaranthus hypochondriacus] 88 1e-15 ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-... 87 2e-15 emb|CAH57531.1| cysteine protease inhibitor [Populus tremula] 87 2e-15 >gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea var. italica] Length = 205 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 SVE+ESLA+FAV+EHNKKENALLEF+RV+KAKEQVV+GTMH LTLE I+ G KK Y Sbjct: 16 SVEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLY 71 >gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera] Length = 199 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 SVE+ESLA+FAV+EHNKKENALLEF+RV+KAKEQVV+GTMH LTLE I+ G KK Y Sbjct: 16 SVEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLY 71 >gb|AAL59842.1| cysteine protease inhibitor CPI-1 [Brassica oleracea] Length = 207 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/56 (78%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 SVE+ESLA+FAV+EHNKKENALLEF+RV+KAKEQVV+GTMH LTLE I+ G KK Y Sbjct: 16 SVEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLY 71 >gb|AGX28139.1| cysteine protease inhibitor, partial [Populus euphratica] gi|549515974|gb|AGX28140.1| cysteine protease inhibitor, partial [Populus euphratica] Length = 107 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/56 (76%), Positives = 52/56 (92%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 SVEI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EAI+ G KK Y Sbjct: 16 SVEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLY 71 >ref|XP_002299179.1| cysteine protease inhibitor family protein [Populus trichocarpa] gi|118482431|gb|ABK93138.1| unknown [Populus trichocarpa] gi|222846437|gb|EEE83984.1| cysteine protease inhibitor family protein [Populus trichocarpa] Length = 200 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/56 (76%), Positives = 52/56 (92%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 SVEIE+LA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EAI+ G KK Y Sbjct: 16 SVEIENLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKIY 71 >gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] Length = 228 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S E+E LA+FAVEEHNKKEN LLEF+RV+KAKEQVV+GT+H LTLEAID G KK Y Sbjct: 44 SAELEELARFAVEEHNKKENRLLEFTRVVKAKEQVVAGTLHYLTLEAIDAGKKKLY 99 >pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold - Full Length Adhiron gi|609412426|pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold - Truncated Adhiron Length = 79 Score = 88.6 bits (218), Expect = 8e-16 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S+EIE LA+FAV+EHNKKENALLEF RV+KAKEQVV+GTM+ LTLEA DGG KK Y Sbjct: 3 SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLY 58 >gb|AGX28141.1| cysteine protease inhibitor, partial [Populus euphratica] gi|549515981|gb|AGX28143.1| cysteine protease inhibitor, partial [Populus euphratica] gi|549515993|gb|AGX28144.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549515997|gb|AGX28145.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549515999|gb|AGX28146.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516001|gb|AGX28147.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516004|gb|AGX28148.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516006|gb|AGX28149.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516008|gb|AGX28150.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516011|gb|AGX28151.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516013|gb|AGX28152.1| cysteine protease inhibitor, partial [Populus pruinosa] Length = 107 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/56 (75%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EAI+ G KK Y Sbjct: 16 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLY 71 >ref|XP_002884906.1| hypothetical protein ARALYDRAFT_897457 [Arabidopsis lyrata subsp. lyrata] gi|297330746|gb|EFH61165.1| hypothetical protein ARALYDRAFT_897457 [Arabidopsis lyrata subsp. lyrata] Length = 202 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S E+ESLA+FAV+EHNKKENALLEF+RV+KAKEQVV+GTMH LTLE +D G KK Y Sbjct: 16 SGEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEILDAGEKKLY 71 >ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 1 [Vitis vinifera] Length = 201 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAVEEHNKKENALLEF+RV+KA+EQVV+GT+H LTLE ID G KK Y Sbjct: 16 SAEIDSLARFAVEEHNKKENALLEFARVVKAEEQVVAGTLHHLTLEVIDAGRKKLY 71 >gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa] Length = 143 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/56 (75%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EAI+ G KK Y Sbjct: 51 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLY 106 >gb|ACO39793.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EA++ G KK Y Sbjct: 35 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLY 90 >gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231580|gb|ACO39783.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231620|gb|ACO39803.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EA++ G KK Y Sbjct: 35 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLY 90 >gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231532|gb|ACO39759.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231534|gb|ACO39760.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231536|gb|ACO39761.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231538|gb|ACO39762.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231540|gb|ACO39763.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231542|gb|ACO39764.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231544|gb|ACO39765.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231546|gb|ACO39766.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231548|gb|ACO39767.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231550|gb|ACO39768.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231552|gb|ACO39769.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231554|gb|ACO39770.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231556|gb|ACO39771.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231558|gb|ACO39772.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231560|gb|ACO39773.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231562|gb|ACO39774.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231564|gb|ACO39775.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231566|gb|ACO39776.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231568|gb|ACO39777.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231570|gb|ACO39778.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231572|gb|ACO39779.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231574|gb|ACO39780.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231576|gb|ACO39781.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231582|gb|ACO39784.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231584|gb|ACO39785.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231586|gb|ACO39786.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231588|gb|ACO39787.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231590|gb|ACO39788.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231592|gb|ACO39789.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231594|gb|ACO39790.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231596|gb|ACO39791.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231598|gb|ACO39792.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231602|gb|ACO39794.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231604|gb|ACO39795.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231606|gb|ACO39796.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231608|gb|ACO39797.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231610|gb|ACO39798.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231612|gb|ACO39799.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231614|gb|ACO39800.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231616|gb|ACO39801.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231618|gb|ACO39802.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231622|gb|ACO39804.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231624|gb|ACO39805.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231626|gb|ACO39806.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231628|gb|ACO39807.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231630|gb|ACO39808.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231632|gb|ACO39809.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231634|gb|ACO39810.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231636|gb|ACO39811.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231638|gb|ACO39812.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231640|gb|ACO39813.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231642|gb|ACO39814.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231644|gb|ACO39815.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231646|gb|ACO39816.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231648|gb|ACO39817.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231650|gb|ACO39818.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231652|gb|ACO39819.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231654|gb|ACO39820.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231656|gb|ACO39821.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231658|gb|ACO39822.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231660|gb|ACO39823.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231662|gb|ACO39824.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231664|gb|ACO39825.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231666|gb|ACO39826.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231668|gb|ACO39827.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231670|gb|ACO39828.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231672|gb|ACO39829.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231674|gb|ACO39830.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231676|gb|ACO39831.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231678|gb|ACO39832.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231680|gb|ACO39833.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231682|gb|ACO39834.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231684|gb|ACO39835.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231686|gb|ACO39836.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231688|gb|ACO39837.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231690|gb|ACO39838.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231692|gb|ACO39839.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231694|gb|ACO39840.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231696|gb|ACO39841.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EA++ G KK Y Sbjct: 35 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLY 90 >ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trichocarpa] gi|222841387|gb|EEE78934.1| cysteine proteinase inhibitor [Populus trichocarpa] Length = 235 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+SLA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EA++ G KK Y Sbjct: 51 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLY 106 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S ++E LA+FAV+EHNKKENALLEF+RV+KA+EQVV+GT+H LTLEAI+GG KK Y Sbjct: 51 SADVEDLARFAVQEHNKKENALLEFARVVKAEEQVVAGTLHHLTLEAIEGGKKKIY 106 >ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citrus clementina] gi|557534490|gb|ESR45608.1| hypothetical protein CICLE_v10002346mg [Citrus clementina] Length = 235 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EIESLA+FA+EEHNKKENALLEF +V+KA+EQVV+GTMH LT+EAID G KK Y Sbjct: 50 SNEIESLARFAIEEHNKKENALLEFVKVVKAQEQVVAGTMHHLTVEAIDAGTKKLY 105 >gb|ABG89856.1| cystatin [Amaranthus hypochondriacus] Length = 247 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +2 Query: 140 EIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 EIESLA+FAV+EHNKKENALLEF+RV+KAKEQVV+GT+H T+EAID G KK Y Sbjct: 59 EIESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHFTIEAIDAGKKKLY 112 >ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-like [Citrus sinensis] Length = 235 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EIESLA+FA+EEHNKKENALLEF +V+KA+EQVV+GTMH LT+EAID G KK Y Sbjct: 50 SNEIESLARFAIEEHNKKENALLEFVKVVKAQEQVVAGTMHHLTVEAIDAGRKKLY 105 >emb|CAH57531.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = +2 Query: 134 SVEIESLAKFAVEEHNKKENALLEFSRVLKAKEQVVSGTMHILTLEAIDGGAKKTY 301 S EI+ LA+FAV+EHNKKENA+LEF+RV+KAKEQVV+GTMH LT+EAI+ G KK Y Sbjct: 51 SAEIDGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLY 106