BLASTX nr result
ID: Akebia24_contig00018650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018650 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC14252.1| hypothetical protein L484_021750 [Morus notabilis] 58 2e-06 >gb|EXC14252.1| hypothetical protein L484_021750 [Morus notabilis] Length = 369 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 3 SEDAVKGDRYGGVAPTWRESETPPLSSWKAE 95 S DAVKGDRYGG + TWRE++TPPLSSWK E Sbjct: 339 SADAVKGDRYGGASGTWREADTPPLSSWKTE 369