BLASTX nr result
ID: Akebia24_contig00016389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00016389 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006285495.1| hypothetical protein CARUB_v10006924mg [Caps... 55 8e-06 >ref|XP_006285495.1| hypothetical protein CARUB_v10006924mg [Capsella rubella] gi|482554200|gb|EOA18393.1| hypothetical protein CARUB_v10006924mg [Capsella rubella] Length = 200 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 486 GAIYIISGVLCIGFLKRARQRKVITAEQAVKD 391 G IYIISGVLCIGFLKRARQ+K I+ EQA+KD Sbjct: 144 GVIYIISGVLCIGFLKRARQQKEISREQAIKD 175