BLASTX nr result
ID: Akebia24_contig00016126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00016126 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006341943.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 77 3e-12 ref|XP_002281422.1| PREDICTED: cytosolic purine 5'-nucleotidase ... 77 3e-12 emb|CAN71801.1| hypothetical protein VITISV_008691 [Vitis vinifera] 77 3e-12 gb|EYU45164.1| hypothetical protein MIMGU_mgv1a004395mg [Mimulus... 74 2e-11 ref|XP_004238263.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 74 2e-11 ref|XP_006473500.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 73 5e-11 ref|XP_006473499.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 73 5e-11 gb|EXB67769.1| hypothetical protein L484_001597 [Morus notabilis] 72 6e-11 ref|XP_004291876.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 72 1e-10 ref|XP_007222816.1| hypothetical protein PRUPE_ppa004247mg [Prun... 72 1e-10 ref|XP_006434989.1| hypothetical protein CICLE_v10000800mg [Citr... 71 1e-10 ref|XP_006856000.1| hypothetical protein AMTR_s00059p00028760 [A... 71 1e-10 ref|XP_007017539.1| HAD-superfamily hydrolase, subfamily IG, 5'-... 71 2e-10 ref|XP_007017538.1| HAD-superfamily hydrolase isoform 1 [Theobro... 71 2e-10 ref|XP_004160036.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 70 3e-10 ref|XP_004152697.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 70 3e-10 ref|XP_002510387.1| cytosolic purine 5-nucleotidase, putative [R... 70 4e-10 ref|NP_001151027.1| cytosolic purine 5-nucleotidase [Zea mays] g... 69 5e-10 gb|EPS70199.1| hypothetical protein M569_04560, partial [Genlise... 69 7e-10 ref|XP_006650668.1| PREDICTED: cytosolic purine 5'-nucleotidase-... 68 2e-09 >ref|XP_006341943.1| PREDICTED: cytosolic purine 5'-nucleotidase-like [Solanum tuberosum] Length = 646 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDIL+I Sbjct: 612 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILSI 646 >ref|XP_002281422.1| PREDICTED: cytosolic purine 5'-nucleotidase [Vitis vinifera] gi|302142495|emb|CBI19698.3| unnamed protein product [Vitis vinifera] Length = 538 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDIL+I Sbjct: 504 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILSI 538 >emb|CAN71801.1| hypothetical protein VITISV_008691 [Vitis vinifera] Length = 106 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDIL+I Sbjct: 72 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILSI 106 >gb|EYU45164.1| hypothetical protein MIMGU_mgv1a004395mg [Mimulus guttatus] Length = 529 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILA 108 CLYTSQVTNLSLYSPDKYYRPSEDFMPHE DILA Sbjct: 495 CLYTSQVTNLSLYSPDKYYRPSEDFMPHELDILA 528 >ref|XP_004238263.1| PREDICTED: cytosolic purine 5'-nucleotidase-like [Solanum lycopersicum] Length = 645 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEF IL+I Sbjct: 611 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFGILSI 645 >ref|XP_006473500.1| PREDICTED: cytosolic purine 5'-nucleotidase-like isoform X2 [Citrus sinensis] Length = 539 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSEDFMPHEFDI+ + Sbjct: 505 CLYTSQVSNLSLYSPDKYYRPSEDFMPHEFDIIPL 539 >ref|XP_006473499.1| PREDICTED: cytosolic purine 5'-nucleotidase-like isoform X1 [Citrus sinensis] Length = 639 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSEDFMPHEFDI+ + Sbjct: 605 CLYTSQVSNLSLYSPDKYYRPSEDFMPHEFDIIPL 639 >gb|EXB67769.1| hypothetical protein L484_001597 [Morus notabilis] Length = 540 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDIL 111 CLYTSQV+NLSLYSPDKYYRPSEDFMPHEFDI+ Sbjct: 506 CLYTSQVSNLSLYSPDKYYRPSEDFMPHEFDII 538 >ref|XP_004291876.1| PREDICTED: cytosolic purine 5'-nucleotidase-like [Fragaria vesca subsp. vesca] Length = 541 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSED+MPHEFDI+ + Sbjct: 507 CLYTSQVSNLSLYSPDKYYRPSEDYMPHEFDIIPL 541 >ref|XP_007222816.1| hypothetical protein PRUPE_ppa004247mg [Prunus persica] gi|462419752|gb|EMJ24015.1| hypothetical protein PRUPE_ppa004247mg [Prunus persica] Length = 520 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSED+MPHEFDI+ + Sbjct: 486 CLYTSQVSNLSLYSPDKYYRPSEDYMPHEFDIIPL 520 >ref|XP_006434989.1| hypothetical protein CICLE_v10000800mg [Citrus clementina] gi|557537111|gb|ESR48229.1| hypothetical protein CICLE_v10000800mg [Citrus clementina] Length = 539 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSEDFMPHEF+I+ + Sbjct: 505 CLYTSQVSNLSLYSPDKYYRPSEDFMPHEFEIIPL 539 >ref|XP_006856000.1| hypothetical protein AMTR_s00059p00028760 [Amborella trichopoda] gi|548859859|gb|ERN17467.1| hypothetical protein AMTR_s00059p00028760 [Amborella trichopoda] Length = 537 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQVTNLSLYSPDKYYR SEDFMPHEFDI+ + Sbjct: 503 CLYTSQVTNLSLYSPDKYYRTSEDFMPHEFDIIEL 537 >ref|XP_007017539.1| HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase isoform 2 [Theobroma cacao] gi|508722867|gb|EOY14764.1| HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase isoform 2 [Theobroma cacao] Length = 538 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSEDFMPHEF IL + Sbjct: 504 CLYTSQVSNLSLYSPDKYYRPSEDFMPHEFHILPL 538 >ref|XP_007017538.1| HAD-superfamily hydrolase isoform 1 [Theobroma cacao] gi|508722866|gb|EOY14763.1| HAD-superfamily hydrolase isoform 1 [Theobroma cacao] Length = 647 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSEDFMPHEF IL + Sbjct: 613 CLYTSQVSNLSLYSPDKYYRPSEDFMPHEFHILPL 647 >ref|XP_004160036.1| PREDICTED: cytosolic purine 5'-nucleotidase-like [Cucumis sativus] Length = 605 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLY+SQVTNLSLYSPDKYYRPSEDFMPHEF I+ + Sbjct: 571 CLYSSQVTNLSLYSPDKYYRPSEDFMPHEFGIIPL 605 >ref|XP_004152697.1| PREDICTED: cytosolic purine 5'-nucleotidase-like [Cucumis sativus] Length = 605 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLY+SQVTNLSLYSPDKYYRPSEDFMPHEF I+ + Sbjct: 571 CLYSSQVTNLSLYSPDKYYRPSEDFMPHEFGIIPL 605 >ref|XP_002510387.1| cytosolic purine 5-nucleotidase, putative [Ricinus communis] gi|223551088|gb|EEF52574.1| cytosolic purine 5-nucleotidase, putative [Ricinus communis] Length = 536 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLYTSQV+NLSLYSPDKYYRPSED+MPHEF +L + Sbjct: 502 CLYTSQVSNLSLYSPDKYYRPSEDYMPHEFHVLPV 536 >ref|NP_001151027.1| cytosolic purine 5-nucleotidase [Zea mays] gi|195643762|gb|ACG41349.1| cytosolic purine 5-nucleotidase [Zea mays] gi|414873115|tpg|DAA51672.1| TPA: cytosolic purine 5-nucleotidase [Zea mays] Length = 570 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLY+SQVTN LYSPDKYYRPSED+MPHEFD+L + Sbjct: 536 CLYSSQVTNFGLYSPDKYYRPSEDYMPHEFDVLGL 570 >gb|EPS70199.1| hypothetical protein M569_04560, partial [Genlisea aurea] Length = 500 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDIL 111 CLYTSQV+NL LYSPDKYYRPSEDFMPHEF IL Sbjct: 468 CLYTSQVSNLGLYSPDKYYRPSEDFMPHEFGIL 500 >ref|XP_006650668.1| PREDICTED: cytosolic purine 5'-nucleotidase-like [Oryza brachyantha] Length = 571 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 209 CLYTSQVTNLSLYSPDKYYRPSEDFMPHEFDILAI 105 CLY+SQVTN +LYSP+KYYRPSED+MPHEFD+L + Sbjct: 537 CLYSSQVTNFALYSPNKYYRPSEDYMPHEFDVLGL 571