BLASTX nr result
ID: Akebia24_contig00015905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00015905 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168988.1| PREDICTED: methyl-CpG-binding domain-contain... 59 9e-07 >ref|XP_004168988.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like [Cucumis sativus] Length = 206 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 1/103 (0%) Frame = -1 Query: 310 TLETPLPLIPYSDGDESST-TPDDLGKKYLPRRPASTSDNSGGQSGFVRYKRRKRAAGLD 134 T P P +P D D + TP + P RP + +G S K+ + + Sbjct: 76 TSTVPSPTLPSRDLDRTPRKTPLTSSTRRSPLRPDPLNSFNGDSSP------SKKVSASN 129 Query: 133 LAVVPTGPETRPKGLPDGWRIEYRVRTGGATAGVIDKFYYDPI 5 A + RP LP GW +E RVR+ GATAG +DK+Y+DP+ Sbjct: 130 SASSKSALSERPNWLPPGWVVEDRVRSSGATAGTVDKYYFDPV 172