BLASTX nr result
ID: Akebia24_contig00015555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00015555 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006388703.1| hypothetical protein POPTR_0115s00220g [Popu... 61 1e-07 ref|XP_002275018.2| PREDICTED: putative disease resistance prote... 56 5e-06 ref|XP_004490578.1| PREDICTED: putative disease resistance prote... 55 8e-06 ref|XP_004490577.1| PREDICTED: putative disease resistance prote... 55 8e-06 >ref|XP_006388703.1| hypothetical protein POPTR_0115s00220g [Populus trichocarpa] gi|550310685|gb|ERP47617.1| hypothetical protein POPTR_0115s00220g [Populus trichocarpa] Length = 1133 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/60 (46%), Positives = 42/60 (70%) Frame = -2 Query: 181 KLGHLTSPQWLSIIISDSLMCMSEELKQLTSLQNLEIY*CSVLGARCQKEVGEDWSIISH 2 ++GHLTS Q+LS++ + L + ++ LTSLQ LEI+ C L RC+K++GEDW I+H Sbjct: 1067 QIGHLTSLQYLSVMKCEGLASLPNQIGYLTSLQCLEIWDCPNLKKRCEKDLGEDWPTIAH 1126 >ref|XP_002275018.2| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Length = 1178 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/59 (50%), Positives = 34/59 (57%) Frame = -2 Query: 178 LGHLTSPQWLSIIISDSLMCMSEELKQLTSLQNLEIY*CSVLGARCQKEVGEDWSIISH 2 +G LTS LSI L + EE++ L L LEIY C L RCQKE GEDW ISH Sbjct: 936 IGSLTSLSNLSIECCPELRSLPEEMRSLRHLHTLEIYRCPYLYERCQKETGEDWPKISH 994 >ref|XP_004490578.1| PREDICTED: putative disease resistance protein RGA1-like isoform X2 [Cicer arietinum] Length = 1014 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = -2 Query: 172 HLTSPQWLSIIISDSLMCMSEELKQLTSLQNLEIY*CSVLGARCQKEVGEDWSIISH 2 HLTS + L+I + L + E ++ LTSL+ L I+ CS L RC+KE+GEDW I+H Sbjct: 951 HLTSLEVLTIHGCEGLRSLPEGIRHLTSLEVLTIHGCSTLKKRCEKEIGEDWDKIAH 1007 >ref|XP_004490577.1| PREDICTED: putative disease resistance protein RGA1-like isoform X1 [Cicer arietinum] Length = 1042 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = -2 Query: 172 HLTSPQWLSIIISDSLMCMSEELKQLTSLQNLEIY*CSVLGARCQKEVGEDWSIISH 2 HLTS + L+I + L + E ++ LTSL+ L I+ CS L RC+KE+GEDW I+H Sbjct: 979 HLTSLEVLTIHGCEGLRSLPEGIRHLTSLEVLTIHGCSTLKKRCEKEIGEDWDKIAH 1035