BLASTX nr result
ID: Akebia24_contig00015303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00015303 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009142.1| WAS/WASL-interacting protein family member 2... 57 3e-06 ref|XP_007009141.1| WAS/WASL-interacting protein family member 2... 57 3e-06 >ref|XP_007009142.1| WAS/WASL-interacting protein family member 2, putative isoform 2 [Theobroma cacao] gi|508726055|gb|EOY17952.1| WAS/WASL-interacting protein family member 2, putative isoform 2 [Theobroma cacao] Length = 344 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 63 MAEDLDDGEFWLPSEFLTDDDILMEKKYININKGRNNIE 179 MAE LDD EFWLP++FLTDDDI+MEK+ + G NN E Sbjct: 1 MAEQLDDAEFWLPAKFLTDDDIVMEKENLKNKNGGNNTE 39 >ref|XP_007009141.1| WAS/WASL-interacting protein family member 2, putative isoform 1 [Theobroma cacao] gi|508726054|gb|EOY17951.1| WAS/WASL-interacting protein family member 2, putative isoform 1 [Theobroma cacao] Length = 413 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 63 MAEDLDDGEFWLPSEFLTDDDILMEKKYININKGRNNIE 179 MAE LDD EFWLP++FLTDDDI+MEK+ + G NN E Sbjct: 1 MAEQLDDAEFWLPAKFLTDDDIVMEKENLKNKNGGNNTE 39