BLASTX nr result
ID: Akebia24_contig00014855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00014855 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 98 1e-18 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 89 8e-16 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = +2 Query: 335 IPSCSSISNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHGPSPVHKE 493 +PSCSSI NQDKPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG KE Sbjct: 558 VPSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHGKISRPKE 610 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -2 Query: 508 VMSVSFFMNRAWTMSPEQSQYIWRKTIPHIEVRMGSGVFTSHRSARFVLIGD 353 + S F+ RAWTMSPEQSQYIWRKTIPHIEV MGSGVFTS+RSARFVLI D Sbjct: 33 IFEKSSFLYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84