BLASTX nr result
ID: Akebia24_contig00014832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00014832 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007147872.1| hypothetical protein PHAVU_006G162000g [Phas... 83 5e-14 gb|EYU43903.1| hypothetical protein MIMGU_mgv1a011840mg [Mimulus... 80 2e-13 ref|XP_002312758.2| zinc finger family protein [Populus trichoca... 80 2e-13 ref|XP_007035497.1| CHY-type/CTCHY-type/RING-type Zinc finger pr... 80 2e-13 ref|XP_007035496.1| CHY-type/CTCHY-type/RING-type Zinc finger pr... 80 2e-13 ref|XP_004296799.1| PREDICTED: RING finger and CHY zinc finger d... 80 2e-13 ref|XP_002516875.1| zinc finger protein, putative [Ricinus commu... 80 2e-13 gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] 80 3e-13 ref|XP_007154233.1| hypothetical protein PHAVU_003G101500g [Phas... 80 4e-13 ref|XP_007223131.1| hypothetical protein PRUPE_ppa010024mg [Prun... 79 5e-13 ref|XP_007223130.1| hypothetical protein PRUPE_ppa010024mg [Prun... 79 5e-13 ref|XP_007223129.1| hypothetical protein PRUPE_ppa010024mg [Prun... 79 5e-13 ref|XP_006419635.1| hypothetical protein CICLE_v10005640mg [Citr... 79 7e-13 ref|XP_006419634.1| hypothetical protein CICLE_v10005640mg [Citr... 79 7e-13 gb|EXB74828.1| RING finger and CHY zinc finger domain-containing... 79 9e-13 gb|AFK47591.1| unknown [Medicago truncatula] 79 9e-13 ref|XP_003593984.1| RING finger and CHY zinc finger domain-conta... 79 9e-13 ref|XP_004486052.1| PREDICTED: RING finger and CHY zinc finger d... 78 1e-12 ref|XP_006600216.1| PREDICTED: uncharacterized protein LOC100812... 78 1e-12 ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycin... 78 1e-12 >ref|XP_007147872.1| hypothetical protein PHAVU_006G162000g [Phaseolus vulgaris] gi|561021095|gb|ESW19866.1| hypothetical protein PHAVU_006G162000g [Phaseolus vulgaris] Length = 267 Score = 82.8 bits (203), Expect = 5e-14 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+GHKC HCNSYNTR+I PPV+PQ Sbjct: 229 ILCNDCNDTTEVYFHIIGHKCGHCNSYNTRSIAPPVLPQ 267 >gb|EYU43903.1| hypothetical protein MIMGU_mgv1a011840mg [Mimulus guttatus] Length = 269 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTRTI PPV+PQ Sbjct: 231 ILCNDCNDTTEVYFHIIGQKCSHCESYNTRTIAPPVLPQ 269 >ref|XP_002312758.2| zinc finger family protein [Populus trichocarpa] gi|550333576|gb|EEE90125.2| zinc finger family protein [Populus trichocarpa] Length = 269 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTRTI PPV+PQ Sbjct: 231 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLPQ 269 >ref|XP_007035497.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 2 [Theobroma cacao] gi|508714526|gb|EOY06423.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 2 [Theobroma cacao] Length = 221 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTRTI PPV+PQ Sbjct: 183 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLPQ 221 >ref|XP_007035496.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma cacao] gi|508714525|gb|EOY06422.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma cacao] Length = 260 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTRTI PPV+PQ Sbjct: 222 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLPQ 260 >ref|XP_004296799.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 267 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE FFHI+G KC+HC SYNTRTI PPV+PQ Sbjct: 229 ILCNDCNDTTEVFFHIIGQKCNHCKSYNTRTIAPPVLPQ 267 >ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis] gi|223543963|gb|EEF45489.1| zinc finger protein, putative [Ricinus communis] Length = 269 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTRTI PPV+PQ Sbjct: 231 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLPQ 269 >gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] Length = 109 Score = 80.1 bits (196), Expect = 3e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTRTI PPV+PQ Sbjct: 70 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIQPPVLPQ 108 >ref|XP_007154233.1| hypothetical protein PHAVU_003G101500g [Phaseolus vulgaris] gi|561027587|gb|ESW26227.1| hypothetical protein PHAVU_003G101500g [Phaseolus vulgaris] Length = 267 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE FHI+GHKC HCNSYNTR+I PPV+PQ Sbjct: 229 ILCNDCNDTTEVNFHILGHKCGHCNSYNTRSIAPPVLPQ 267 >ref|XP_007223131.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica] gi|462420067|gb|EMJ24330.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica] Length = 220 Score = 79.3 bits (194), Expect = 5e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KC+HC SYNTRTI PPV+PQ Sbjct: 182 ILCNDCNDTTEVYFHIIGQKCNHCKSYNTRTIAPPVLPQ 220 >ref|XP_007223130.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica] gi|462420066|gb|EMJ24329.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica] Length = 267 Score = 79.3 bits (194), Expect = 5e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KC+HC SYNTRTI PPV+PQ Sbjct: 229 ILCNDCNDTTEVYFHIIGQKCNHCKSYNTRTIAPPVLPQ 267 >ref|XP_007223129.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica] gi|462420065|gb|EMJ24328.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica] Length = 248 Score = 79.3 bits (194), Expect = 5e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KC+HC SYNTRTI PPV+PQ Sbjct: 210 ILCNDCNDTTEVYFHIIGQKCNHCKSYNTRTIAPPVLPQ 248 >ref|XP_006419635.1| hypothetical protein CICLE_v10005640mg [Citrus clementina] gi|568871920|ref|XP_006489126.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Citrus sinensis] gi|557521508|gb|ESR32875.1| hypothetical protein CICLE_v10005640mg [Citrus clementina] Length = 267 Score = 79.0 bits (193), Expect = 7e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTR+I PPV+PQ Sbjct: 229 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPVLPQ 267 >ref|XP_006419634.1| hypothetical protein CICLE_v10005640mg [Citrus clementina] gi|557521507|gb|ESR32874.1| hypothetical protein CICLE_v10005640mg [Citrus clementina] Length = 220 Score = 79.0 bits (193), Expect = 7e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KCSHC SYNTR+I PPV+PQ Sbjct: 182 ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPVLPQ 220 >gb|EXB74828.1| RING finger and CHY zinc finger domain-containing protein 1 [Morus notabilis] Length = 261 Score = 78.6 bits (192), Expect = 9e-13 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KC HC SYNTRTI PPV+PQ Sbjct: 223 ILCNDCNDTTEVYFHIIGQKCRHCKSYNTRTIAPPVLPQ 261 >gb|AFK47591.1| unknown [Medicago truncatula] Length = 267 Score = 78.6 bits (192), Expect = 9e-13 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE FHI+GHKC HC+SYNTR I PPV+PQ Sbjct: 229 ILCNDCNDTTEVSFHIIGHKCGHCSSYNTRAIAPPVLPQ 267 >ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355483032|gb|AES64235.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Length = 267 Score = 78.6 bits (192), Expect = 9e-13 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE FHI+GHKC HC+SYNTR I PPV+PQ Sbjct: 229 ILCNDCNDTTEVSFHIIGHKCGHCSSYNTRAIAPPVLPQ 267 >ref|XP_004486052.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cicer arietinum] Length = 267 Score = 78.2 bits (191), Expect = 1e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE FHI+GHKC HC+SYNTR I PPV+PQ Sbjct: 229 ILCNDCNDTTEVNFHIIGHKCGHCSSYNTRAIAPPVLPQ 267 >ref|XP_006600216.1| PREDICTED: uncharacterized protein LOC100812839 isoform X1 [Glycine max] Length = 262 Score = 77.8 bits (190), Expect = 1e-12 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KC HC SYNTRT+ PPV+PQ Sbjct: 224 ILCNDCNDTTEVYFHILGQKCGHCRSYNTRTVAPPVLPQ 262 >ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycine max] gi|255636475|gb|ACU18576.1| unknown [Glycine max] Length = 267 Score = 77.8 bits (190), Expect = 1e-12 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 2 ILCNDCNDTTETFFHIVGHKCSHCNSYNTRTITPPVVPQ 118 ILCNDCNDTTE +FHI+G KC HC SYNTRT+ PPV+PQ Sbjct: 229 ILCNDCNDTTEVYFHILGQKCGHCRSYNTRTVAPPVLPQ 267