BLASTX nr result
ID: Akebia24_contig00014653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00014653 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC02131.1| NAC domain-containing protein 78 [Morus notabilis] 58 1e-06 >gb|EXC02131.1| NAC domain-containing protein 78 [Morus notabilis] Length = 744 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/72 (44%), Positives = 45/72 (62%) Frame = +1 Query: 1 FVICRLFKKDGKDGKTEYPNCDEIDLTGSSPTTNRSSPEGSPSNKAKAQAMPMPDMQIGE 180 FV+CRLF+K + K++ DE++ TGSSPT +SSP+ + S+ + A DM IGE Sbjct: 159 FVLCRLFRKP--EEKSDALKHDEVNQTGSSPTITKSSPDDTSSDLLQETA--PSDMPIGE 214 Query: 181 QPTVTERWQTVK 216 +P V RW T K Sbjct: 215 EPEVINRWSTEK 226