BLASTX nr result
ID: Akebia24_contig00014590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00014590 (754 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] 70 8e-10 ref|XP_007027153.1| RNA-binding family protein with retrovirus z... 65 3e-08 ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prun... 63 1e-07 >gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] Length = 431 Score = 70.1 bits (170), Expect = 8e-10 Identities = 49/117 (41%), Positives = 56/117 (47%) Frame = -1 Query: 352 LHPPRVVFFNLNDLVEGFWVFARPGGLW*EGALGGFGRYSXXXXXXXXXXXXXXXCVFVW 173 LHP +V D+V G + + W EGALGG G YS Sbjct: 75 LHPMALVI----DMVLGAYPTSVSMVDWWEGALGGIGGYSRK------------------ 112 Query: 172 KWQPSQSGVLFI*GAKYHTLTYLNHDGLTVSGKHFRRVRDVDMKHDFAFVEFSDPRD 2 FI + T YL DG+TVSG HF RVR VDMKH+FAFVEFSDPRD Sbjct: 113 ----------FI--LRGDTFLYLRLDGVTVSGNHFHRVRHVDMKHEFAFVEFSDPRD 157 >ref|XP_007027153.1| RNA-binding family protein with retrovirus zinc finger-like domain, putative [Theobroma cacao] gi|508715758|gb|EOY07655.1| RNA-binding family protein with retrovirus zinc finger-like domain, putative [Theobroma cacao] Length = 312 Score = 65.1 bits (157), Expect = 3e-08 Identities = 32/60 (53%), Positives = 38/60 (63%) Frame = -1 Query: 181 FVWKWQPSQSGVLFI*GAKYHTLTYLNHDGLTVSGKHFRRVRDVDMKHDFAFVEFSDPRD 2 F W+P G + YL++DGLTVS +FRR+RDVDMKHDFAFVE S PRD Sbjct: 40 FCLTWRPMVRGSALAELVEIPAQCYLSNDGLTVSSNNFRRIRDVDMKHDFAFVELSYPRD 99 >ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica] gi|462401284|gb|EMJ06841.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica] Length = 282 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 115 LTYLNHDGLTVSGKHFRRVRDVDMKHDFAFVEFSDPRD 2 L YL++D LTVSG RRVRDVDMK +FAFVEFSDPRD Sbjct: 3 LKYLSNDSLTVSGNRLRRVRDVDMKREFAFVEFSDPRD 40