BLASTX nr result
ID: Akebia24_contig00011492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00011492 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006439092.1| hypothetical protein CICLE_v10031806mg [Citr... 83 5e-14 ref|XP_006482858.1| PREDICTED: uncharacterized protein LOC102613... 82 8e-14 gb|EYU29037.1| hypothetical protein MIMGU_mgv1a008265mg [Mimulus... 78 1e-12 gb|EXB32767.1| hypothetical protein L484_012496 [Morus notabilis] 78 1e-12 ref|XP_007052506.1| F17A17.35 protein [Theobroma cacao] gi|50870... 78 1e-12 ref|XP_004307214.1| PREDICTED: uncharacterized protein LOC101315... 78 1e-12 ref|XP_003535838.1| PREDICTED: uncharacterized protein LOC100803... 78 1e-12 ref|XP_002517815.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 ref|XP_002313310.2| hypothetical protein POPTR_0009s06470g [Popu... 77 2e-12 gb|ABK96472.1| unknown [Populus trichocarpa x Populus deltoides] 77 2e-12 ref|XP_002313311.2| hypothetical protein POPTR_0009s06450g [Popu... 77 2e-12 ref|XP_004135937.1| PREDICTED: uncharacterized protein LOC101208... 77 2e-12 ref|XP_006838298.1| hypothetical protein AMTR_s00103p00115980 [A... 77 3e-12 ref|XP_007218132.1| hypothetical protein PRUPE_ppa007132mg [Prun... 76 4e-12 ref|XP_006345307.1| PREDICTED: uncharacterized protein LOC102603... 76 6e-12 ref|XP_004231464.1| PREDICTED: uncharacterized protein LOC101248... 76 6e-12 emb|CBI24914.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002278058.1| PREDICTED: uncharacterized protein LOC100243... 75 1e-11 ref|XP_007148911.1| hypothetical protein PHAVU_005G024500g [Phas... 74 2e-11 ref|XP_004499896.1| PREDICTED: uncharacterized protein LOC101513... 74 2e-11 >ref|XP_006439092.1| hypothetical protein CICLE_v10031806mg [Citrus clementina] gi|557541288|gb|ESR52332.1| hypothetical protein CICLE_v10031806mg [Citrus clementina] Length = 383 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRL 242 SRP++DIRGKK+WELVVCDG LSLQYTK+FPN VIN ITLKEA++ + Sbjct: 107 SRPIIDIRGKKIWELVVCDGSLSLQYTKYFPNNVINSITLKEAIVAI 153 >ref|XP_006482858.1| PREDICTED: uncharacterized protein LOC102613093 [Citrus sinensis] Length = 383 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRL 242 SRP++DIRGKK+WELVVCDG LSLQYTK+FPN VIN ITLKEA++ + Sbjct: 107 SRPILDIRGKKIWELVVCDGSLSLQYTKYFPNNVINSITLKEAIVAI 153 >gb|EYU29037.1| hypothetical protein MIMGU_mgv1a008265mg [Mimulus guttatus] Length = 379 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRL 242 SRP++DIRGKKVWELVVCD LSLQYTK+FPN VIN +TLK+A++ + Sbjct: 103 SRPILDIRGKKVWELVVCDDSLSLQYTKYFPNNVINSVTLKDAIVTI 149 >gb|EXB32767.1| hypothetical protein L484_012496 [Morus notabilis] Length = 376 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKKVWELVVCD LSLQYTK+FPN VIN +TLK+A++ ++ Sbjct: 100 SRPIIDIRGKKVWELVVCDESLSLQYTKYFPNNVINSVTLKDAILGIS 147 >ref|XP_007052506.1| F17A17.35 protein [Theobroma cacao] gi|508704767|gb|EOX96663.1| F17A17.35 protein [Theobroma cacao] Length = 426 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKK+WELVVCD LSLQYTK+FPN VIN ITLK+A++ ++ Sbjct: 130 SRPILDIRGKKIWELVVCDTSLSLQYTKYFPNNVINSITLKDAIVSIS 177 >ref|XP_004307214.1| PREDICTED: uncharacterized protein LOC101315382 [Fragaria vesca subsp. vesca] Length = 370 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKKVWELVVCD LSLQ+TK+FPN VIN ITLKEA++ ++ Sbjct: 94 SRPILDIRGKKVWELVVCDESLSLQHTKYFPNNVINSITLKEAIVAIS 141 >ref|XP_003535838.1| PREDICTED: uncharacterized protein LOC100803590 [Glycine max] Length = 378 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++D+RGKK+WELVVCD LSLQYTK+FPN VIN ITLK+A++ ++ Sbjct: 103 SRPILDVRGKKIWELVVCDKTLSLQYTKYFPNNVINSITLKDAIVAVS 150 >ref|XP_002517815.1| conserved hypothetical protein [Ricinus communis] gi|223543087|gb|EEF44622.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKKVWELVVCD LSLQ+TK+FPN VIN ITLK+AL+ ++ Sbjct: 101 SRPILDIRGKKVWELVVCDDSLSLQFTKYFPNNVINSITLKDALVSVS 148 >ref|XP_002313310.2| hypothetical protein POPTR_0009s06470g [Populus trichocarpa] gi|550331167|gb|EEE87265.2| hypothetical protein POPTR_0009s06470g [Populus trichocarpa] Length = 376 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLAM 248 SRP++D+RGKKVWELVVCD LSLQ+TK+FPN VIN ITLK+A++ +++ Sbjct: 100 SRPILDVRGKKVWELVVCDDSLSLQFTKYFPNNVINSITLKDAIVSISV 148 >gb|ABK96472.1| unknown [Populus trichocarpa x Populus deltoides] Length = 376 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLAM 248 SRP++D+RGKKVWELVVCD LSLQ+TK+FPN VIN ITLK+A++ +++ Sbjct: 100 SRPILDVRGKKVWELVVCDDSLSLQFTKYFPNNVINSITLKDAIVSISV 148 >ref|XP_002313311.2| hypothetical protein POPTR_0009s06450g [Populus trichocarpa] gi|550331165|gb|EEE87266.2| hypothetical protein POPTR_0009s06450g [Populus trichocarpa] Length = 376 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++D+RGKKVWELVVCD LSLQ+TK+FPN VIN ITLK+A++ ++ Sbjct: 100 SRPILDVRGKKVWELVVCDDSLSLQFTKYFPNNVINSITLKDAIVSIS 147 >ref|XP_004135937.1| PREDICTED: uncharacterized protein LOC101208052 [Cucumis sativus] gi|449488836|ref|XP_004158187.1| PREDICTED: uncharacterized protein LOC101230638 [Cucumis sativus] Length = 379 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKKVWELVVCD LSLQYTK+FPN VIN ITL++A+ +A Sbjct: 103 SRPILDIRGKKVWELVVCDNSLSLQYTKYFPNNVINSITLRDAVSSIA 150 >ref|XP_006838298.1| hypothetical protein AMTR_s00103p00115980 [Amborella trichopoda] gi|548840766|gb|ERN00867.1| hypothetical protein AMTR_s00103p00115980 [Amborella trichopoda] Length = 368 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKK+WELVVCDG LSLQ+TK FPN VIN ITL++A++ ++ Sbjct: 92 SRPILDIRGKKLWELVVCDGTLSLQFTKFFPNNVINSITLRDAIVLIS 139 >ref|XP_007218132.1| hypothetical protein PRUPE_ppa007132mg [Prunus persica] gi|462414594|gb|EMJ19331.1| hypothetical protein PRUPE_ppa007132mg [Prunus persica] Length = 381 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKKVWELVVCD LSLQ+TK+FPN VIN ITLK+A++ ++ Sbjct: 105 SRPILDIRGKKVWELVVCDESLSLQHTKYFPNNVINSITLKDAIVTVS 152 >ref|XP_006345307.1| PREDICTED: uncharacterized protein LOC102603144 [Solanum tuberosum] Length = 374 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKK+WEL+VCD LSLQYTK+FPN +IN ITLK+AL+ ++ Sbjct: 98 SRPILDIRGKKLWELLVCDDSLSLQYTKYFPNNLINSITLKDALLSIS 145 >ref|XP_004231464.1| PREDICTED: uncharacterized protein LOC101248056 [Solanum lycopersicum] Length = 365 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++DIRGKK+WEL+VCD LSLQYTK+FPN +IN ITLK+AL+ ++ Sbjct: 89 SRPILDIRGKKLWELLVCDDSLSLQYTKYFPNNLINSITLKDALLSIS 136 >emb|CBI24914.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEAL 233 SRP++DIRGKK+WEL+VCD LSLQYTK+FPN VIN +TLK A+ Sbjct: 22 SRPILDIRGKKIWELLVCDSSLSLQYTKYFPNNVINSVTLKNAI 65 >ref|XP_002278058.1| PREDICTED: uncharacterized protein LOC100243060 [Vitis vinifera] Length = 378 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEAL 233 SRP++DIRGKK+WEL+VCD LSLQYTK+FPN VIN +TLK A+ Sbjct: 102 SRPILDIRGKKIWELLVCDSSLSLQYTKYFPNNVINSVTLKNAI 145 >ref|XP_007148911.1| hypothetical protein PHAVU_005G024500g [Phaseolus vulgaris] gi|561022175|gb|ESW20905.1| hypothetical protein PHAVU_005G024500g [Phaseolus vulgaris] Length = 395 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRLA 245 SRP++D RGKK+WELVVCD LSLQYTK+FPN VIN +TLK+ ++ ++ Sbjct: 120 SRPILDARGKKIWELVVCDKTLSLQYTKYFPNNVINSVTLKDGIVAVS 167 >ref|XP_004499896.1| PREDICTED: uncharacterized protein LOC101513700 [Cicer arietinum] Length = 374 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = +3 Query: 102 SRPMVDIRGKKVWELVVCDGILSLQYTKHFPNKVINGITLKEALIRL 242 SRP++D RGKK+WELVVCD LSLQYTK+FPN VIN ITLK++++ + Sbjct: 98 SRPILDARGKKLWELVVCDKSLSLQYTKYFPNNVINSITLKDSIVAI 144