BLASTX nr result
ID: Akebia24_contig00011098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00011098 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74403.1| hypothetical protein L484_004222 [Morus notabilis] 58 1e-06 >gb|EXB74403.1| hypothetical protein L484_004222 [Morus notabilis] Length = 67 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/57 (59%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = -3 Query: 220 MALNNW*FTCAVDVPRNFGSKQNRIQKK--SFLFPDLQETLDAITLLEFMKSK*SML 56 MAL N T A VP+NFG+KQN+IQKK S LFP+LQET D EFMK K S L Sbjct: 1 MALINRKLTYAKGVPKNFGNKQNKIQKKQRSLLFPELQETTDVSVAFEFMKIKLSNL 57