BLASTX nr result
ID: Akebia24_contig00011017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00011017 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005415549.1| hypothetical protein RSPPHO_03240, partial [... 61 1e-07 >ref|YP_005415549.1| hypothetical protein RSPPHO_03240, partial [Rhodospirillum photometricum DSM 122] gi|384260383|ref|YP_005415569.1| hypothetical protein RSPPHO_03260, partial [Rhodospirillum photometricum DSM 122] gi|504226122|ref|WP_014413224.1| hypothetical protein, partial [Rhodospirillum photometricum] gi|378401463|emb|CCG06579.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] gi|378401483|emb|CCG06599.1| unnamed protein product, partial [Rhodospirillum photometricum DSM 122] Length = 106 Score = 60.8 bits (146), Expect(2) = 1e-07 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -2 Query: 129 FPKRAYPVLAQVSLSYSEPEGTFPRVTHPSAADPEGPARLACV 1 FP+RAY VL VS YS +GTFPRVTHP A PEG RLACV Sbjct: 13 FPRRAYTVLVLVSKDYSVLQGTFPRVTHPCATHPEGCVRLACV 55 Score = 20.8 bits (42), Expect(2) = 1e-07 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 166 LIRRGPIFRQ*TFPQK 119 LI RGPI + +FP++ Sbjct: 1 LIGRGPILERNSFPRR 16