BLASTX nr result
ID: Akebia24_contig00010426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00010426 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504171.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 67 3e-09 ref|XP_006305097.1| hypothetical protein CARUB_v10009466mg [Caps... 65 8e-09 ref|NP_174350.2| UDP-arabinose 4-epimerase 1 [Arabidopsis thalia... 65 8e-09 ref|XP_003630000.1| UDP-D-xylose 4-epimerase [Medicago truncatul... 65 8e-09 ref|XP_003629999.1| UDP-D-xylose 4-epimerase [Medicago truncatul... 65 8e-09 ref|XP_002529901.1| UDP-glucose 4-epimerase, putative [Ricinus c... 65 8e-09 ref|NP_001077632.1| UDP-arabinose 4-epimerase 1 [Arabidopsis tha... 65 8e-09 dbj|BAD94059.1| UDP-galactose 4-epimerase-like protein [Arabidop... 65 8e-09 gb|AAN60309.1| unknown [Arabidopsis thaliana] 65 8e-09 ref|XP_007159601.1| hypothetical protein PHAVU_002G251100g [Phas... 65 1e-08 ref|XP_007211748.1| hypothetical protein PRUPE_ppa006315mg [Prun... 65 1e-08 ref|XP_002317687.1| MURUS 4 family protein [Populus trichocarpa]... 65 1e-08 ref|XP_002300551.1| MURUS 4 family protein [Populus trichocarpa]... 65 1e-08 gb|EXB75167.1| UDP-arabinose 4-epimerase 1 [Morus notabilis] 64 2e-08 ref|XP_006413863.1| hypothetical protein EUTSA_v10025334mg [Eutr... 64 2e-08 ref|XP_006398059.1| hypothetical protein EUTSA_v10000899mg [Eutr... 64 2e-08 ref|XP_006283838.1| hypothetical protein CARUB_v10004939mg [Caps... 64 2e-08 ref|XP_006280554.1| hypothetical protein CARUB_v10026495mg [Caps... 64 2e-08 ref|NP_199261.1| putative UDP-arabinose 4-epimerase 4 [Arabidops... 64 2e-08 ref|XP_002867878.1| predicted protein [Arabidopsis lyrata subsp.... 64 2e-08 >ref|XP_004504171.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Cicer arietinum] gi|502140334|ref|XP_004504172.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Cicer arietinum] gi|502140336|ref|XP_004504173.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X3 [Cicer arietinum] gi|502140338|ref|XP_004504174.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X4 [Cicer arietinum] gi|502140340|ref|XP_004504175.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X5 [Cicer arietinum] Length = 416 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFSRNSDMAVMILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRYFNV 250 >ref|XP_006305097.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|565494918|ref|XP_006305098.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|565494920|ref|XP_006305099.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|482573808|gb|EOA37995.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|482573809|gb|EOA37996.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] gi|482573810|gb|EOA37997.1| hypothetical protein CARUB_v10009466mg [Capsella rubella] Length = 376 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 173 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 208 >ref|NP_174350.2| UDP-arabinose 4-epimerase 1 [Arabidopsis thaliana] gi|79318985|ref|NP_001031118.1| UDP-arabinose 4-epimerase 1 [Arabidopsis thaliana] gi|75313130|sp|Q9SA77.1|ARAE1_ARATH RecName: Full=UDP-arabinose 4-epimerase 1; AltName: Full=UDP-D-xylose 4-epimerase 1 gi|4587518|gb|AAD25749.1|AC007060_7 Strong similarity to F19I3.8 gi|3033381 putative UDP-galactose-4-epimerase from Arabidopsis thaliana BAC gb|AC004238 and is a member of PF|01370 the NAD dependent epimerase/dehydratase family. EST gb|AA597338 comes from this gene [Arabidopsis thaliana] gi|13272475|gb|AAK17176.1|AF325108_1 unknown protein [Arabidopsis thaliana] gi|18086329|gb|AAL57628.1| At1g30620/T5I8_7 [Arabidopsis thaliana] gi|27363222|gb|AAO11530.1| At1g30620/T5I8_7 [Arabidopsis thaliana] gi|28395529|gb|AAO39213.1| UDP-D-xylose 4-epimerase [Arabidopsis thaliana] gi|222423784|dbj|BAH19858.1| AT1G30620 [Arabidopsis thaliana] gi|332193130|gb|AEE31251.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] gi|332193131|gb|AEE31252.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] Length = 419 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 250 >ref|XP_003630000.1| UDP-D-xylose 4-epimerase [Medicago truncatula] gi|355524022|gb|AET04476.1| UDP-D-xylose 4-epimerase [Medicago truncatula] Length = 266 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 66 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 101 >ref|XP_003629999.1| UDP-D-xylose 4-epimerase [Medicago truncatula] gi|355524021|gb|AET04475.1| UDP-D-xylose 4-epimerase [Medicago truncatula] Length = 397 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 197 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 232 >ref|XP_002529901.1| UDP-glucose 4-epimerase, putative [Ricinus communis] gi|223530628|gb|EEF32504.1| UDP-glucose 4-epimerase, putative [Ricinus communis] Length = 417 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 250 >ref|NP_001077632.1| UDP-arabinose 4-epimerase 1 [Arabidopsis thaliana] gi|332193132|gb|AEE31253.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] Length = 418 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 214 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 249 >dbj|BAD94059.1| UDP-galactose 4-epimerase-like protein [Arabidopsis thaliana] Length = 237 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 33 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 68 >gb|AAN60309.1| unknown [Arabidopsis thaliana] Length = 419 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 250 >ref|XP_007159601.1| hypothetical protein PHAVU_002G251100g [Phaseolus vulgaris] gi|593793126|ref|XP_007159602.1| hypothetical protein PHAVU_002G251100g [Phaseolus vulgaris] gi|593793128|ref|XP_007159603.1| hypothetical protein PHAVU_002G251100g [Phaseolus vulgaris] gi|561033016|gb|ESW31595.1| hypothetical protein PHAVU_002G251100g [Phaseolus vulgaris] gi|561033017|gb|ESW31596.1| hypothetical protein PHAVU_002G251100g [Phaseolus vulgaris] gi|561033018|gb|ESW31597.1| hypothetical protein PHAVU_002G251100g [Phaseolus vulgaris] Length = 416 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMA+MILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAIMILRYFNV 250 >ref|XP_007211748.1| hypothetical protein PRUPE_ppa006315mg [Prunus persica] gi|462407613|gb|EMJ12947.1| hypothetical protein PRUPE_ppa006315mg [Prunus persica] gi|464895971|gb|AGH25534.1| UDP-D-xylose 4-epimerase [Prunus persica] Length = 417 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMAVM+LR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAVMVLRYFNV 250 >ref|XP_002317687.1| MURUS 4 family protein [Populus trichocarpa] gi|566195747|ref|XP_006377908.1| hypothetical protein POPTR_0011s15960g [Populus trichocarpa] gi|222860752|gb|EEE98299.1| MURUS 4 family protein [Populus trichocarpa] gi|550328504|gb|ERP55705.1| hypothetical protein POPTR_0011s15960g [Populus trichocarpa] Length = 417 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMA+MILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAIMILRYFNV 250 >ref|XP_002300551.1| MURUS 4 family protein [Populus trichocarpa] gi|222847809|gb|EEE85356.1| MURUS 4 family protein [Populus trichocarpa] Length = 417 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAEDIILDFS+NSDMA+MILR +V Sbjct: 215 VPINPYGKAKKMAEDIILDFSKNSDMAIMILRYFNV 250 >gb|EXB75167.1| UDP-arabinose 4-epimerase 1 [Morus notabilis] Length = 417 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 +PINPYGKAKKMAEDIILDFS+NSDMAVMILR +V Sbjct: 215 LPINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNV 250 >ref|XP_006413863.1| hypothetical protein EUTSA_v10025334mg [Eutrema salsugineum] gi|557115033|gb|ESQ55316.1| hypothetical protein EUTSA_v10025334mg [Eutrema salsugineum] Length = 411 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAED+ILDFS+NSDMAVMILR +V Sbjct: 214 VPINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV 249 >ref|XP_006398059.1| hypothetical protein EUTSA_v10000899mg [Eutrema salsugineum] gi|557099148|gb|ESQ39512.1| hypothetical protein EUTSA_v10000899mg [Eutrema salsugineum] Length = 412 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAED+ILDFS+NSDMAVMILR +V Sbjct: 215 VPINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV 250 >ref|XP_006283838.1| hypothetical protein CARUB_v10004939mg [Capsella rubella] gi|482552543|gb|EOA16736.1| hypothetical protein CARUB_v10004939mg [Capsella rubella] Length = 410 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAED+ILDFS+NSDMAVMILR +V Sbjct: 213 VPINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV 248 >ref|XP_006280554.1| hypothetical protein CARUB_v10026495mg [Capsella rubella] gi|482549258|gb|EOA13452.1| hypothetical protein CARUB_v10026495mg [Capsella rubella] Length = 412 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAED+ILDFS+NSDMAVMILR +V Sbjct: 215 VPINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV 250 >ref|NP_199261.1| putative UDP-arabinose 4-epimerase 4 [Arabidopsis thaliana] gi|75309104|sp|Q9FI17.1|ARAE4_ARATH RecName: Full=Putative UDP-arabinose 4-epimerase 4; AltName: Full=UDP-D-xylose 4-epimerase 4 gi|9758701|dbj|BAB09155.1| unnamed protein product [Arabidopsis thaliana] gi|332007730|gb|AED95113.1| putative UDP-arabinose 4-epimerase 4 [Arabidopsis thaliana] Length = 436 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAED+ILDFS+NSDMAVMILR +V Sbjct: 239 VPINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV 274 >ref|XP_002867878.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313714|gb|EFH44137.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 391 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 269 VPINPYGKAKKMAEDIILDFSRNSDMAVMILRCSSV 162 VPINPYGKAKKMAED+ILDFS+NSDMAVMILR +V Sbjct: 194 VPINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV 229