BLASTX nr result
ID: Akebia24_contig00009840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00009840 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL94180.1| Conserved hypothetical protein [Malus domestica] 57 3e-06 >emb|CBL94180.1| Conserved hypothetical protein [Malus domestica] Length = 200 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSVQTPPLSDKDQEEKASRSEFVQGLLLSTMFDD 102 RSVQ PPLS KDQEE+A R EFVQGLL+ST+FDD Sbjct: 166 RSVQQPPLSRKDQEEQARRCEFVQGLLMSTIFDD 199