BLASTX nr result
ID: Akebia24_contig00009518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00009518 (706 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40504.2| Polyprotein, putative [Solanum demissum] 60 7e-07 gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu] 57 5e-06 >gb|AAT40504.2| Polyprotein, putative [Solanum demissum] Length = 868 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -1 Query: 262 VIDDITAPIQEQVP*CLLFANDVVLDDEMRERVNTKLEFWRDELE 128 V+D++T IQE VP C+LFA+D+VL DE R+RVN +LE WR LE Sbjct: 419 VMDELTRSIQETVPWCMLFADDIVLIDETRDRVNARLEVWRQTLE 463 >gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu] Length = 1140 Score = 57.4 bits (137), Expect = 5e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -1 Query: 262 VIDDITAPIQEQVP*CLLFANDVVLDDEMRERVNTKLEFWRDELE 128 V+D++T IQ +P C+LFA DVVLDD+ R VN KLE WR LE Sbjct: 585 VMDEVTRDIQGDIPWCMLFAEDVVLDDDSRTGVNRKLELWRQTLE 629