BLASTX nr result
ID: Akebia24_contig00009163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00009163 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595724.1| hypothetical protein MTR_2g059740 [Medicago ... 56 6e-06 >ref|XP_003595724.1| hypothetical protein MTR_2g059740 [Medicago truncatula] gi|355484772|gb|AES65975.1| hypothetical protein MTR_2g059740 [Medicago truncatula] Length = 167 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = +3 Query: 132 WVVSFDVYDTQTIPNWLIIRAVGGDYTNSNALDPIRIPRLSVL*G-RVILGWVTSWEVLV 308 WV S++V L++ D+T++NA DPIR P+LSVL RV+LGWVTSWEVLV Sbjct: 93 WVTSWEV---------LVLHLFLCDHTSTNAPDPIRTPQLSVLGRPRVVLGWVTSWEVLV 143 Query: 309 L 311 L Sbjct: 144 L 144