BLASTX nr result
ID: Akebia24_contig00008605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00008605 (633 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66601.1| Putative chloride channel-like protein CLC-g [Mor... 58 2e-06 ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citr... 58 2e-06 gb|EYU34964.1| hypothetical protein MIMGU_mgv1a001646mg [Mimulus... 57 5e-06 ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prun... 57 6e-06 gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays] g... 56 8e-06 >gb|EXB66601.1| Putative chloride channel-like protein CLC-g [Morus notabilis] Length = 796 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 418 HRSTPSSNS*VAIVGAELCPIESLDYEIVENDFDKQD 528 HRS P+S S VAIVG+ +CPIESLDYEI EN+F KQD Sbjct: 30 HRSNPNSTSQVAIVGSHVCPIESLDYEIFENEFFKQD 66 >ref|XP_006453099.1| hypothetical protein CICLE_v10007502mg [Citrus clementina] gi|567922188|ref|XP_006453100.1| hypothetical protein CICLE_v10007502mg [Citrus clementina] gi|567922190|ref|XP_006453101.1| hypothetical protein CICLE_v10007502mg [Citrus clementina] gi|568840903|ref|XP_006474404.1| PREDICTED: putative chloride channel-like protein CLC-g-like isoform X1 [Citrus sinensis] gi|568840905|ref|XP_006474405.1| PREDICTED: putative chloride channel-like protein CLC-g-like isoform X2 [Citrus sinensis] gi|557556325|gb|ESR66339.1| hypothetical protein CICLE_v10007502mg [Citrus clementina] gi|557556326|gb|ESR66340.1| hypothetical protein CICLE_v10007502mg [Citrus clementina] gi|557556327|gb|ESR66341.1| hypothetical protein CICLE_v10007502mg [Citrus clementina] Length = 794 Score = 58.2 bits (139), Expect = 2e-06 Identities = 35/80 (43%), Positives = 49/80 (61%) Frame = +1 Query: 346 GVYRDEEALSLIVLLLDHRNELVLHRSTPSSNS*VAIVGAELCPIESLDYEIVENDFDKQ 525 GV ++ SL V LL H+ S +S S VA+VGA++CPIESLDYEI ENDF K+ Sbjct: 23 GVEGGQDPESLTVPLLSHQRS---RSSISNSTSQVALVGADVCPIESLDYEIAENDFFKE 79 Query: 526 DTPLDGYRRVLL*IPWWLRW 585 D G +++ I +++W Sbjct: 80 DWRTRGRNQMIQYI--FMKW 97 >gb|EYU34964.1| hypothetical protein MIMGU_mgv1a001646mg [Mimulus guttatus] Length = 779 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 412 VLHRSTPSSNS*VAIVGAELCPIESLDYEIVENDFDKQD 528 +L RS +S S VA+VG+ LCP+ESLDYEI+ENDF KQD Sbjct: 31 LLQRSRSNSTSQVAVVGSNLCPVESLDYEIIENDFFKQD 69 >ref|XP_007204268.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica] gi|462399799|gb|EMJ05467.1| hypothetical protein PRUPE_ppa001699mg [Prunus persica] Length = 777 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = +1 Query: 421 RSTPSSNS*VAIVGAELCPIESLDYEIVENDFDKQDTPLDGYRRVL--L*IPWWL 579 RS P+S S VA+VGA +CPIESLDYEI+EN+F KQD G +V + + W+L Sbjct: 28 RSAPNSTSQVALVGANVCPIESLDYEILENEFFKQDWRSRGKMQVFQYIFMKWFL 82 >gb|AFW58337.1| hypothetical protein ZEAMMB73_926410 [Zea mays] gi|413918406|gb|AFW58338.1| hypothetical protein ZEAMMB73_926410 [Zea mays] gi|413918407|gb|AFW58339.1| hypothetical protein ZEAMMB73_926410 [Zea mays] Length = 795 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +1 Query: 394 DHRNELVLHRSTPSSNS*VAIVGAELCPIESLDYEIVENDFDKQD 528 D E +L R T ++ S +AIVGA +CPIESLDYEIVEND KQD Sbjct: 51 DGPREPLLRRRTMNTTSQIAIVGANICPIESLDYEIVENDLFKQD 95