BLASTX nr result
ID: Akebia24_contig00008340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00008340 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531736.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 >ref|XP_002531736.1| conserved hypothetical protein [Ricinus communis] gi|223528639|gb|EEF30656.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 22 DRGLVVPASAAMQWKGRSLNRPPSFFLFKDTKAVQRD 132 DRGL+VPASAAMQWKGRSLNRPPSFF K + + D Sbjct: 26 DRGLIVPASAAMQWKGRSLNRPPSFFSKKKSSTKRLD 62