BLASTX nr result
ID: Akebia24_contig00005758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00005758 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003558983.1| PREDICTED: serine/threonine-protein kinase S... 60 2e-07 ref|XP_006412293.1| hypothetical protein EUTSA_v10025907mg [Eutr... 58 2e-06 ref|XP_004982436.1| PREDICTED: serine/threonine-protein kinase S... 58 2e-06 ref|XP_007042346.1| Kinase superfamily protein isoform 3 [Theobr... 58 2e-06 ref|XP_007042345.1| Kinase superfamily protein isoform 2 [Theobr... 58 2e-06 ref|XP_007042344.1| Kinase superfamily protein isoform 1 [Theobr... 58 2e-06 ref|XP_006283988.1| hypothetical protein CARUB_v10005110mg [Caps... 58 2e-06 gb|AFW64009.1| putative snRK/SAPK family protein kinase [Zea mays] 58 2e-06 pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With... 58 2e-06 pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase... 58 2e-06 pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase gi|3506... 58 2e-06 dbj|BAJ34451.1| unnamed protein product [Thellungiella halophila] 58 2e-06 ref|XP_002869183.1| hypothetical protein ARALYDRAFT_491280 [Arab... 58 2e-06 ref|XP_002464236.1| hypothetical protein SORBIDRAFT_01g014720 [S... 58 2e-06 gb|ACG32779.1| serine/threonine-protein kinase SAPK10 [Zea mays] 58 2e-06 gb|ACF84233.1| unknown [Zea mays] gi|414871889|tpg|DAA50446.1| T... 58 2e-06 ref|NP_001130868.1| SnRK2.10 [Zea mays] gi|194690310|gb|ACF79239... 58 2e-06 ref|NP_001130186.1| uncharacterized LOC100191280 [Zea mays] gi|1... 58 2e-06 ref|NP_001119111.1| calcium-independent ABA-activated protein ki... 58 2e-06 emb|CAA19877.1| protein kinase-like protein [Arabidopsis thalian... 58 2e-06 >ref|XP_003558983.1| PREDICTED: serine/threonine-protein kinase SAPK8-like isoform 3 [Brachypodium distachyon] Length = 301 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKVMLS*LYNV 177 SQPKSTVGTPAYIAPEVLLKKEYDGK +LS Y++ Sbjct: 148 SQPKSTVGTPAYIAPEVLLKKEYDGKRILSVQYSI 182 >ref|XP_006412293.1| hypothetical protein EUTSA_v10025907mg [Eutrema salsugineum] gi|557113463|gb|ESQ53746.1| hypothetical protein EUTSA_v10025907mg [Eutrema salsugineum] Length = 287 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197 >ref|XP_004982436.1| PREDICTED: serine/threonine-protein kinase SAPK10-like [Setaria italica] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 173 SQPKSTVGTPAYIAPEVLLKKEYDGKV 199 >ref|XP_007042346.1| Kinase superfamily protein isoform 3 [Theobroma cacao] gi|508706281|gb|EOX98177.1| Kinase superfamily protein isoform 3 [Theobroma cacao] Length = 268 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 78 SQPKSTVGTPAYIAPEVLLKKEYDGKV 104 >ref|XP_007042345.1| Kinase superfamily protein isoform 2 [Theobroma cacao] gi|590686330|ref|XP_007042347.1| Kinase superfamily protein isoform 2 [Theobroma cacao] gi|508706280|gb|EOX98176.1| Kinase superfamily protein isoform 2 [Theobroma cacao] gi|508706282|gb|EOX98178.1| Kinase superfamily protein isoform 2 [Theobroma cacao] Length = 363 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 173 SQPKSTVGTPAYIAPEVLLKKEYDGKV 199 >ref|XP_007042344.1| Kinase superfamily protein isoform 1 [Theobroma cacao] gi|508706279|gb|EOX98175.1| Kinase superfamily protein isoform 1 [Theobroma cacao] Length = 370 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 180 SQPKSTVGTPAYIAPEVLLKKEYDGKV 206 >ref|XP_006283988.1| hypothetical protein CARUB_v10005110mg [Capsella rubella] gi|482552693|gb|EOA16886.1| hypothetical protein CARUB_v10005110mg [Capsella rubella] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197 >gb|AFW64009.1| putative snRK/SAPK family protein kinase [Zea mays] Length = 368 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 237 SQPKSTVGTPAYIAPEVLLKKEYDGKV 263 >pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 170 SQPKSTVGTPAYIAPEVLLKKEYDGKV 196 >pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 gi|361132387|pdb|3UC4|B Chain B, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197 >pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase gi|350610868|pdb|3ZUT|B Chain B, The Structure Of Ost1 (D160a) Kinase Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197 >dbj|BAJ34451.1| unnamed protein product [Thellungiella halophila] Length = 363 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197 >ref|XP_002869183.1| hypothetical protein ARALYDRAFT_491280 [Arabidopsis lyrata subsp. lyrata] gi|297315019|gb|EFH45442.1| hypothetical protein ARALYDRAFT_491280 [Arabidopsis lyrata subsp. lyrata] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197 >ref|XP_002464236.1| hypothetical protein SORBIDRAFT_01g014720 [Sorghum bicolor] gi|241918090|gb|EER91234.1| hypothetical protein SORBIDRAFT_01g014720 [Sorghum bicolor] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 173 SQPKSTVGTPAYIAPEVLLKKEYDGKV 199 >gb|ACG32779.1| serine/threonine-protein kinase SAPK10 [Zea mays] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 173 SQPKSTVGTPAYIAPEVLLKKEYDGKV 199 >gb|ACF84233.1| unknown [Zea mays] gi|414871889|tpg|DAA50446.1| TPA: putative snRK/SAPK family protein kinase [Zea mays] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 173 SQPKSTVGTPAYIAPEVLLKKEYDGKV 199 >ref|NP_001130868.1| SnRK2.10 [Zea mays] gi|194690310|gb|ACF79239.1| unknown [Zea mays] gi|195549571|gb|ACG50013.1| SnRK2.10 [Zea mays] gi|219885515|gb|ACL53132.1| unknown [Zea mays] gi|223943707|gb|ACN25937.1| unknown [Zea mays] gi|413933673|gb|AFW68224.1| putative snRK/SAPK family protein kinase [Zea mays] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 173 SQPKSTVGTPAYIAPEVLLKKEYDGKV 199 >ref|NP_001130186.1| uncharacterized LOC100191280 [Zea mays] gi|194688494|gb|ACF78331.1| unknown [Zea mays] gi|414871888|tpg|DAA50445.1| TPA: putative snRK/SAPK family protein kinase [Zea mays] Length = 367 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 176 SQPKSTVGTPAYIAPEVLLKKEYDGKV 202 >ref|NP_001119111.1| calcium-independent ABA-activated protein kinase [Arabidopsis thaliana] gi|332660900|gb|AEE86300.1| calcium-independent ABA-activated protein kinase [Arabidopsis thaliana] Length = 314 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 123 SQPKSTVGTPAYIAPEVLLKKEYDGKV 149 >emb|CAA19877.1| protein kinase-like protein [Arabidopsis thaliana] gi|7270344|emb|CAB80112.1| protein kinase-like protein [Arabidopsis thaliana] Length = 357 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 281 SQPKSTVGTPAYIAPEVLLKKEYDGKV 201 SQPKSTVGTPAYIAPEVLLKKEYDGKV Sbjct: 171 SQPKSTVGTPAYIAPEVLLKKEYDGKV 197