BLASTX nr result
ID: Akebia24_contig00005396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00005396 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis ... 65 8e-09 >ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis aphrodite subsp. formosana] gi|58802845|gb|AAW82565.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 81 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +3 Query: 3 ATTGVGESESKRGFLTSFSHSKPCMRLSSRTAP 101 ATTGVGESESKRGFLTS SHSKPCMRLS RTAP Sbjct: 48 ATTGVGESESKRGFLTSLSHSKPCMRLSPRTAP 80