BLASTX nr result
ID: Akebia24_contig00005277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00005277 (227 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006486160.1| PREDICTED: probable methionine--tRNA ligase-... 66 4e-09 ref|XP_007218100.1| hypothetical protein PRUPE_ppa006649mg [Prun... 66 4e-09 ref|XP_007011286.1| OB-fold nucleic acid binding domain-containi... 65 1e-08 ref|XP_007011282.1| OB-fold nucleic acid binding domain-containi... 65 1e-08 ref|XP_007011280.1| OB-fold nucleic acid binding domain-containi... 65 1e-08 ref|XP_002520877.1| methionyl-tRNA synthetase, putative [Ricinus... 65 1e-08 gb|EXB96539.1| putative methionine--tRNA ligase [Morus notabilis] 64 3e-08 ref|XP_006357315.1| PREDICTED: methionine--tRNA ligase, cytoplas... 64 3e-08 ref|XP_004240846.1| PREDICTED: probable methionine--tRNA ligase-... 64 3e-08 ref|XP_002325488.1| hypothetical protein POPTR_0019s08680g [Popu... 63 4e-08 ref|XP_002275301.2| PREDICTED: uncharacterized tRNA-binding prot... 63 5e-08 emb|CAN60565.1| hypothetical protein VITISV_013997 [Vitis vinifera] 63 5e-08 ref|XP_007136419.1| hypothetical protein PHAVU_009G043500g [Phas... 62 6e-08 ref|XP_003526802.1| PREDICTED: uncharacterized tRNA-binding prot... 61 1e-07 ref|XP_006411333.1| hypothetical protein EUTSA_v10016505mg [Eutr... 60 2e-07 ref|XP_006294100.1| hypothetical protein CARUB_v10023092mg [Caps... 60 2e-07 ref|XP_002879883.1| tRNA-binding region domain-containing protei... 60 2e-07 ref|NP_001240878.1| uncharacterized protein LOC100809851 [Glycin... 60 3e-07 ref|XP_004502825.1| PREDICTED: probable methionine--tRNA ligase-... 57 2e-06 ref|XP_004502824.1| PREDICTED: probable methionine--tRNA ligase-... 57 2e-06 >ref|XP_006486160.1| PREDICTED: probable methionine--tRNA ligase-like [Citrus sinensis] Length = 408 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTSAGPCTSSIPKASIK Sbjct: 378 TDDKGVATFKGIPFMTSAGPCTSSIPKASIK 408 >ref|XP_007218100.1| hypothetical protein PRUPE_ppa006649mg [Prunus persica] gi|462414562|gb|EMJ19299.1| hypothetical protein PRUPE_ppa006649mg [Prunus persica] Length = 401 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTSAGPCTSSIPKASIK Sbjct: 371 TDDKGVATFKGIPFMTSAGPCTSSIPKASIK 401 >ref|XP_007011286.1| OB-fold nucleic acid binding domain-containing protein isoform 7 [Theobroma cacao] gi|508728199|gb|EOY20096.1| OB-fold nucleic acid binding domain-containing protein isoform 7 [Theobroma cacao] Length = 351 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+KG+ATFKGIPFMTSAGPCTSSIPKASIK Sbjct: 321 TDEKGVATFKGIPFMTSAGPCTSSIPKASIK 351 >ref|XP_007011282.1| OB-fold nucleic acid binding domain-containing protein isoform 3 [Theobroma cacao] gi|508728195|gb|EOY20092.1| OB-fold nucleic acid binding domain-containing protein isoform 3 [Theobroma cacao] Length = 390 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+KG+ATFKGIPFMTSAGPCTSSIPKASIK Sbjct: 360 TDEKGVATFKGIPFMTSAGPCTSSIPKASIK 390 >ref|XP_007011280.1| OB-fold nucleic acid binding domain-containing protein isoform 1 [Theobroma cacao] gi|508728193|gb|EOY20090.1| OB-fold nucleic acid binding domain-containing protein isoform 1 [Theobroma cacao] Length = 409 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+KG+ATFKGIPFMTSAGPCTSSIPKASIK Sbjct: 379 TDEKGVATFKGIPFMTSAGPCTSSIPKASIK 409 >ref|XP_002520877.1| methionyl-tRNA synthetase, putative [Ricinus communis] gi|223540008|gb|EEF41586.1| methionyl-tRNA synthetase, putative [Ricinus communis] Length = 391 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTS GPCTSSIPKASIK Sbjct: 361 TDDKGVATFKGIPFMTSGGPCTSSIPKASIK 391 >gb|EXB96539.1| putative methionine--tRNA ligase [Morus notabilis] Length = 380 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+KG+ATFKGIPFMTSAGPCTSSIPKA+IK Sbjct: 350 TDEKGVATFKGIPFMTSAGPCTSSIPKATIK 380 >ref|XP_006357315.1| PREDICTED: methionine--tRNA ligase, cytoplasmic-like [Solanum tuberosum] Length = 422 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTSAGPCTSSIP+A++K Sbjct: 392 TDDKGVATFKGIPFMTSAGPCTSSIPRATVK 422 >ref|XP_004240846.1| PREDICTED: probable methionine--tRNA ligase-like [Solanum lycopersicum] Length = 386 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTSAGPCTSSIP+A++K Sbjct: 356 TDDKGVATFKGIPFMTSAGPCTSSIPRATVK 386 >ref|XP_002325488.1| hypothetical protein POPTR_0019s08680g [Populus trichocarpa] gi|566236850|ref|XP_006371288.1| hypothetical protein POPTR_0019s08680g [Populus trichocarpa] gi|222862363|gb|EEE99869.1| hypothetical protein POPTR_0019s08680g [Populus trichocarpa] gi|550317036|gb|ERP49085.1| hypothetical protein POPTR_0019s08680g [Populus trichocarpa] Length = 425 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 +DDKG+ATFKGIPFMTS GPCTSSIPKASIK Sbjct: 395 SDDKGVATFKGIPFMTSGGPCTSSIPKASIK 425 >ref|XP_002275301.2| PREDICTED: uncharacterized tRNA-binding protein C30C2.04-like [Vitis vinifera] gi|297736480|emb|CBI25351.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTS GPCT SIPKASIK Sbjct: 362 TDDKGVATFKGIPFMTSGGPCTCSIPKASIK 392 >emb|CAN60565.1| hypothetical protein VITISV_013997 [Vitis vinifera] Length = 523 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTS GPCT SIPKASIK Sbjct: 493 TDDKGVATFKGIPFMTSGGPCTCSIPKASIK 523 >ref|XP_007136419.1| hypothetical protein PHAVU_009G043500g [Phaseolus vulgaris] gi|561009506|gb|ESW08413.1| hypothetical protein PHAVU_009G043500g [Phaseolus vulgaris] Length = 389 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+ATFKGIPFMTS GPCTSSIP+A+IK Sbjct: 359 TDDKGVATFKGIPFMTSGGPCTSSIPRATIK 389 >ref|XP_003526802.1| PREDICTED: uncharacterized tRNA-binding protein C30C2.04-like [Glycine max] Length = 390 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+AT+KGIPFMTS GPCTSSIP+A+IK Sbjct: 360 TDDKGVATYKGIPFMTSGGPCTSSIPRATIK 390 >ref|XP_006411333.1| hypothetical protein EUTSA_v10016505mg [Eutrema salsugineum] gi|557112502|gb|ESQ52786.1| hypothetical protein EUTSA_v10016505mg [Eutrema salsugineum] Length = 528 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+ G+AT+KGIPFMTSAGPCTSSIPKA+IK Sbjct: 498 TDESGVATYKGIPFMTSAGPCTSSIPKATIK 528 >ref|XP_006294100.1| hypothetical protein CARUB_v10023092mg [Capsella rubella] gi|482562808|gb|EOA26998.1| hypothetical protein CARUB_v10023092mg [Capsella rubella] Length = 489 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+ G+AT+KGIPFMTSAGPCTSSIPKA+IK Sbjct: 459 TDENGVATYKGIPFMTSAGPCTSSIPKATIK 489 >ref|XP_002879883.1| tRNA-binding region domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325722|gb|EFH56142.1| tRNA-binding region domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 389 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TD+ G+AT+KGIPFMTSAGPCTSSIPKA+IK Sbjct: 359 TDENGVATYKGIPFMTSAGPCTSSIPKATIK 389 >ref|NP_001240878.1| uncharacterized protein LOC100809851 [Glycine max] gi|255636276|gb|ACU18478.1| unknown [Glycine max] Length = 389 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDDKG+AT+KGIPFMTS GPCTSSIP+A+I+ Sbjct: 359 TDDKGVATYKGIPFMTSGGPCTSSIPRATIR 389 >ref|XP_004502825.1| PREDICTED: probable methionine--tRNA ligase-like isoform X2 [Cicer arietinum] Length = 385 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDD G+ATFKGIPFMTS GPCTSSI +A+IK Sbjct: 355 TDDNGVATFKGIPFMTSGGPCTSSISRATIK 385 >ref|XP_004502824.1| PREDICTED: probable methionine--tRNA ligase-like isoform X1 [Cicer arietinum] Length = 387 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 TDDKGIATFKGIPFMTSAGPCTSSIPKASIK 94 TDD G+ATFKGIPFMTS GPCTSSI +A+IK Sbjct: 357 TDDNGVATFKGIPFMTSGGPCTSSISRATIK 387