BLASTX nr result
ID: Akebia24_contig00004769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00004769 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homo... 123 3e-26 emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] 123 3e-26 ref|XP_004172505.1| PREDICTED: ubiquitin-related modifier 1 homo... 122 5e-26 ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homo... 122 7e-26 ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homo... 122 7e-26 ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis]... 121 9e-26 ref|XP_007134950.1| hypothetical protein PHAVU_010G089300g [Phas... 120 1e-25 ref|XP_006445187.1| hypothetical protein CICLE_v10023026mg [Citr... 120 1e-25 ref|NP_001118872.1| ubiquitin-related modifier 1 [Arabidopsis th... 120 1e-25 ref|XP_007223737.1| hypothetical protein PRUPE_ppa013867mg [Prun... 120 2e-25 ref|XP_006397750.1| hypothetical protein EUTSA_v10001692mg [Eutr... 120 3e-25 gb|AFK34500.1| unknown [Medicago truncatula] 120 3e-25 ref|XP_002878362.1| predicted protein [Arabidopsis lyrata subsp.... 119 3e-25 ref|XP_004288565.1| PREDICTED: ubiquitin-related modifier 1 homo... 119 4e-25 ref|XP_007051961.1| Ubiquitin related modifier 1 [Theobroma caca... 119 6e-25 ref|XP_006295297.1| hypothetical protein CARUB_v10024387mg [Caps... 119 6e-25 gb|ABK28333.1| unknown [Arabidopsis thaliana] 118 7e-25 ref|NP_001078064.1| ubiquitin-related modifier 1-1 [Arabidopsis ... 118 7e-25 gb|EYU22914.1| hypothetical protein MIMGU_mgv1a016971mg [Mimulus... 117 2e-24 gb|AFK38209.1| unknown [Lotus japonicus] gi|388506328|gb|AFK4123... 117 2e-24 >ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homolog 2 isoform 1 [Vitis vinifera] gi|296089135|emb|CBI38838.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 123 bits (308), Expect = 3e-26 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDV+VFISTLHGG Sbjct: 40 LSWVRANLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVIVFISTLHGG 99 >emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] Length = 105 Score = 123 bits (308), Expect = 3e-26 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDV+VFISTLHGG Sbjct: 46 LSWVRANLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVIVFISTLHGG 105 >ref|XP_004172505.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Length = 101 Score = 122 bits (306), Expect = 5e-26 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG Sbjct: 42 LSWVRANLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 101 >ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Length = 101 Score = 122 bits (305), Expect = 7e-26 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG Sbjct: 42 LSWVRSNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 101 >ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Length = 99 Score = 122 bits (305), Expect = 7e-26 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG Sbjct: 40 LSWVRSNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis] gi|223548957|gb|EEF50446.1| Protein C9orf74, putative [Ricinus communis] Length = 99 Score = 121 bits (304), Expect = 9e-26 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 L+WVR NLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG Sbjct: 40 LAWVRNNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_007134950.1| hypothetical protein PHAVU_010G089300g [Phaseolus vulgaris] gi|561007995|gb|ESW06944.1| hypothetical protein PHAVU_010G089300g [Phaseolus vulgaris] Length = 99 Score = 120 bits (302), Expect = 1e-25 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDT+LEEKDVVVFISTLHGG Sbjct: 40 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTSLEEKDVVVFISTLHGG 99 >ref|XP_006445187.1| hypothetical protein CICLE_v10023026mg [Citrus clementina] gi|568875800|ref|XP_006490978.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Citrus sinensis] gi|557547449|gb|ESR58427.1| hypothetical protein CICLE_v10023026mg [Citrus clementina] Length = 99 Score = 120 bits (302), Expect = 1e-25 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWV NLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG Sbjct: 40 LSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|NP_001118872.1| ubiquitin-related modifier 1 [Arabidopsis thaliana] gi|238692413|sp|B3H7G2.1|URM12_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 2 gi|332646635|gb|AEE80156.1| ubiquitin-related modifier 1 [Arabidopsis thaliana] Length = 99 Score = 120 bits (302), Expect = 1e-25 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLE+KDV+VFISTLHGG Sbjct: 40 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEDKDVIVFISTLHGG 99 >ref|XP_007223737.1| hypothetical protein PRUPE_ppa013867mg [Prunus persica] gi|462420673|gb|EMJ24936.1| hypothetical protein PRUPE_ppa013867mg [Prunus persica] Length = 99 Score = 120 bits (301), Expect = 2e-25 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSW+R NLIKERPEMFMKGD+VRPGVL LVNDCDWELSGQLDTTLEEKDVVVFISTLHGG Sbjct: 40 LSWIRTNLIKERPEMFMKGDTVRPGVLALVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_006397750.1| hypothetical protein EUTSA_v10001692mg [Eutrema salsugineum] gi|557098823|gb|ESQ39203.1| hypothetical protein EUTSA_v10001692mg [Eutrema salsugineum] Length = 99 Score = 120 bits (300), Expect = 3e-25 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTT+E+KDV+VFISTLHGG Sbjct: 40 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTIEDKDVIVFISTLHGG 99 >gb|AFK34500.1| unknown [Medicago truncatula] Length = 101 Score = 120 bits (300), Expect = 3e-25 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQL TTLEEKDVVVFISTLHGG Sbjct: 42 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLSTTLEEKDVVVFISTLHGG 101 >ref|XP_002878362.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324200|gb|EFH54621.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 94 Score = 119 bits (299), Expect = 3e-25 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR N+IKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLE+KDV+VFISTLHGG Sbjct: 35 LSWVRTNVIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEDKDVIVFISTLHGG 94 >ref|XP_004288565.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like isoform 1 [Fragaria vesca subsp. vesca] gi|470104342|ref|XP_004288566.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like isoform 2 [Fragaria vesca subsp. vesca] Length = 99 Score = 119 bits (298), Expect = 4e-25 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 L+W+R NLIKERPEMFMKGDSVRPGVL LVNDCDWEL+GQLDTTLEEKDVVVFISTLHGG Sbjct: 40 LAWIRTNLIKERPEMFMKGDSVRPGVLALVNDCDWELTGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_007051961.1| Ubiquitin related modifier 1 [Theobroma cacao] gi|508704222|gb|EOX96118.1| Ubiquitin related modifier 1 [Theobroma cacao] Length = 99 Score = 119 bits (297), Expect = 6e-25 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR +LIKERPEMFMKG+SVRPGVLVLVNDCDWEL+GQLDTTLEEKDVVVFISTLHGG Sbjct: 40 LSWVRTDLIKERPEMFMKGESVRPGVLVLVNDCDWELTGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_006295297.1| hypothetical protein CARUB_v10024387mg [Capsella rubella] gi|482564005|gb|EOA28195.1| hypothetical protein CARUB_v10024387mg [Capsella rubella] Length = 101 Score = 119 bits (297), Expect = 6e-25 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDT +EEKDV+VFISTLHGG Sbjct: 42 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTRIEEKDVIVFISTLHGG 101 >gb|ABK28333.1| unknown [Arabidopsis thaliana] Length = 102 Score = 118 bits (296), Expect = 7e-25 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDT +E+KDVVVFISTLHGG Sbjct: 42 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG 101 >ref|NP_001078064.1| ubiquitin-related modifier 1-1 [Arabidopsis thaliana] gi|229557933|sp|A0MDQ1.2|URM11_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 1 gi|62318675|dbj|BAD95172.1| hypothetical protein [Arabidopsis thaliana] gi|98961773|gb|ABF59216.1| unknown protein [Arabidopsis thaliana] gi|330255494|gb|AEC10588.1| ubiquitin-related modifier 1-1 [Arabidopsis thaliana] Length = 101 Score = 118 bits (296), Expect = 7e-25 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDT +E+KDVVVFISTLHGG Sbjct: 42 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG 101 >gb|EYU22914.1| hypothetical protein MIMGU_mgv1a016971mg [Mimulus guttatus] Length = 99 Score = 117 bits (293), Expect = 2e-24 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQL+T LE+KDVVVFISTLHGG Sbjct: 40 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLETMLEDKDVVVFISTLHGG 99 >gb|AFK38209.1| unknown [Lotus japonicus] gi|388506328|gb|AFK41230.1| unknown [Lotus japonicus] Length = 99 Score = 117 bits (293), Expect = 2e-24 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -3 Query: 210 LSWVRINLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 31 LSWVR NLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQL T+LE+KDVVVFISTLHGG Sbjct: 40 LSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLSTSLEDKDVVVFISTLHGG 99