BLASTX nr result
ID: Akebia24_contig00003496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00003496 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029634.1| Structural constituent of ribosome, putative... 63 4e-08 ref|XP_002517768.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 ref|XP_002314056.2| hypothetical protein POPTR_0009s06220g [Popu... 59 5e-07 >ref|XP_007029634.1| Structural constituent of ribosome, putative [Theobroma cacao] gi|508718239|gb|EOY10136.1| Structural constituent of ribosome, putative [Theobroma cacao] Length = 290 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 203 PFTETSKFSTDTKLNYSLASPNGSNPVTRFVRSTESNIERAIFDFRF 343 PF E+S+ + LNY+LA+PNG NP+ RF RSTESNIE+ IFDFRF Sbjct: 76 PFVESSRPHDSSSLNYALANPNG-NPMVRFARSTESNIEKTIFDFRF 121 >ref|XP_002517768.1| conserved hypothetical protein [Ricinus communis] gi|223543040|gb|EEF44575.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = +2 Query: 203 PFTETSKFSTDTKLNYSLASPNGSNPVTRFVRSTESNIERAIFDFRF 343 PF E+S+ S ++ NY+ A+P+GS+PV +FVRSTESNIER IFDFRF Sbjct: 69 PFAESSR-SHNSSFNYAFANPSGSSPVVQFVRSTESNIERIIFDFRF 114 >ref|XP_002314056.2| hypothetical protein POPTR_0009s06220g [Populus trichocarpa] gi|550331147|gb|EEE88011.2| hypothetical protein POPTR_0009s06220g [Populus trichocarpa] Length = 271 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +2 Query: 191 HSIPPFTETSKFSTDTKLNYSLASPNGSNPVTRFVRSTESNIERAIFDFRF 343 H P E+S+ D+ NY+LA+P+ +N V +F+RSTESNIERAIFDFRF Sbjct: 53 HPSKPLVESSRAPPDSGFNYALANPS-ANRVVQFIRSTESNIERAIFDFRF 102