BLASTX nr result
ID: Akebia24_contig00003290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00003290 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842102.1| hypothetical protein AMTR_s00078p00085160 [A... 65 1e-08 >ref|XP_006842102.1| hypothetical protein AMTR_s00078p00085160 [Amborella trichopoda] gi|548844151|gb|ERN03777.1| hypothetical protein AMTR_s00078p00085160 [Amborella trichopoda] Length = 305 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -2 Query: 133 MAGGRVYGSSNMTVLLQNEGIPCSSETFEALLTN----SFHGSRSMVN 2 MAGGRVYG SN+ V+LQ EG+PCSS+ +ALL + SFHG+RSMVN Sbjct: 1 MAGGRVYGGSNLNVVLQGEGLPCSSDALDALLVSCSSPSFHGARSMVN 48