BLASTX nr result
ID: Akebia24_contig00002356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00002356 (751 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS62068.1| DNA-directed RNA polymerase subunit alpha [Tritic... 59 7e-12 >gb|EMS62068.1| DNA-directed RNA polymerase subunit alpha [Triticum urartu] Length = 430 Score = 58.9 bits (141), Expect(2) = 7e-12 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = -2 Query: 600 NTYMTLWKKRFTGFNFPELQLSIAKNSVFTVTGKCSIPK*AYKFDHDQVLFGSSH 436 N MTL KK F F+FP+L L + + + GKCSI K AYKFDHDQ+L G SH Sbjct: 374 NDSMTLGKKSFIRFSFPKLHLQLLIENNPILMGKCSISKWAYKFDHDQLLCGLSH 428 Score = 38.1 bits (87), Expect(2) = 7e-12 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 718 EFLWIHPPKEPDMIIFHHPA 659 E IHPPKEPDM I+HHPA Sbjct: 335 ELFRIHPPKEPDMRIYHHPA 354