BLASTX nr result
ID: Akebia24_contig00002167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00002167 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338855.1| PREDICTED: arginyl-tRNA--protein transferase... 71 1e-10 ref|XP_004240947.1| PREDICTED: arginyl-tRNA--protein transferase... 68 1e-09 ref|XP_007009019.1| Arginine-tRNA protein transferase 1, putativ... 65 1e-08 emb|CBI25497.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002271416.1| PREDICTED: arginyl-tRNA--protein transferase... 61 1e-07 ref|XP_002526898.1| Arginyl-tRNA--protein transferase, putative ... 61 1e-07 ref|XP_003600872.1| Metallocarboxypeptidase inhibitor [Medicago ... 59 7e-07 gb|EXB58203.1| Arginyl-tRNA--protein transferase 1 [Morus notabi... 58 1e-06 ref|XP_006435715.1| hypothetical protein CICLE_v10030943mg [Citr... 57 2e-06 ref|XP_004307634.1| PREDICTED: arginyl-tRNA--protein transferase... 57 2e-06 ref|XP_007220533.1| hypothetical protein PRUPE_ppa002749mg [Prun... 57 3e-06 gb|EYU22341.1| hypothetical protein MIMGU_mgv1a003491mg [Mimulus... 56 5e-06 emb|CAN63217.1| hypothetical protein VITISV_033853 [Vitis vinifera] 56 6e-06 >ref|XP_006338855.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Solanum tuberosum] Length = 640 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = -1 Query: 331 RMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 R+R+KDL+QAFGS E Y+E+QLHRYM+AVG+ LSERMVYSLG Sbjct: 598 RLRYKDLRQAFGSGERRYMETQLHRYMRAVGAELSERMVYSLG 640 >ref|XP_004240947.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Solanum lycopersicum] Length = 640 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/43 (69%), Positives = 39/43 (90%) Frame = -1 Query: 331 RMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 R+R+KDL+QAFGS E ++E+QLH+YM+AVG+ LSERMVYSLG Sbjct: 598 RLRYKDLRQAFGSRERRFMETQLHKYMRAVGAELSERMVYSLG 640 >ref|XP_007009019.1| Arginine-tRNA protein transferase 1, putative isoform 1 [Theobroma cacao] gi|508725932|gb|EOY17829.1| Arginine-tRNA protein transferase 1, putative isoform 1 [Theobroma cacao] Length = 628 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 334 NRMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 +R+R+KDLQ AFG +E NYLE QLH Y + VG LSERMVYSLG Sbjct: 585 SRLRYKDLQPAFGPTERNYLEMQLHNYQRVVGLELSERMVYSLG 628 >emb|CBI25497.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 328 MRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 +RFKDLQ AFG SE YLE+QL RYM+AVG+ ++ RMVYSLG Sbjct: 492 VRFKDLQHAFGPSERAYLETQLRRYMRAVGAEVAGRMVYSLG 533 >ref|XP_002271416.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Vitis vinifera] Length = 640 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 328 MRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 +RFKDLQ AFG SE YLE+QL RYM+AVG+ ++ RMVYSLG Sbjct: 599 VRFKDLQHAFGPSERAYLETQLRRYMRAVGAEVAGRMVYSLG 640 >ref|XP_002526898.1| Arginyl-tRNA--protein transferase, putative [Ricinus communis] gi|223533797|gb|EEF35529.1| Arginyl-tRNA--protein transferase, putative [Ricinus communis] Length = 629 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -1 Query: 334 NRMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 +R+R+K+L++AF SE +YLESQLHRY VG+ LSER+VYSLG Sbjct: 586 SRVRYKELRRAFDPSERSYLESQLHRYKSVVGAELSERIVYSLG 629 >ref|XP_003600872.1| Metallocarboxypeptidase inhibitor [Medicago truncatula] gi|355489920|gb|AES71123.1| Metallocarboxypeptidase inhibitor [Medicago truncatula] Length = 626 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -1 Query: 334 NRMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 +R+R+KDLQ FG + YLESQL +Y + VG LSERMVYSLG Sbjct: 583 SRVRYKDLQSVFGREQQRYLESQLQKYRRVVGPVLSERMVYSLG 626 >gb|EXB58203.1| Arginyl-tRNA--protein transferase 1 [Morus notabilis] Length = 656 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = -1 Query: 328 MRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 +++KDLQ+AF S+ +YLE+QLHRY++ VG + ERM+YSLG Sbjct: 615 LKYKDLQRAFRPSKRSYLETQLHRYLRVVGKEVGERMIYSLG 656 >ref|XP_006435715.1| hypothetical protein CICLE_v10030943mg [Citrus clementina] gi|568865957|ref|XP_006486331.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Citrus sinensis] gi|557537911|gb|ESR48955.1| hypothetical protein CICLE_v10030943mg [Citrus clementina] Length = 636 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 331 RMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 R+R+KD+Q+ FG + LESQL +YMK VG+ LSERMVY+LG Sbjct: 591 RVRYKDIQRVFGPIQRRSLESQLRKYMKVVGAELSERMVYALG 633 >ref|XP_004307634.1| PREDICTED: arginyl-tRNA--protein transferase 1-like isoform 2 [Fragaria vesca subsp. vesca] Length = 619 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -1 Query: 334 NRMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSL 206 +R+RFKD++QAFG +E +YLESQL RY + VG L+ RMVYS+ Sbjct: 576 SRVRFKDIKQAFGPTERSYLESQLSRYTEVVGEELAGRMVYSI 618 >ref|XP_007220533.1| hypothetical protein PRUPE_ppa002749mg [Prunus persica] gi|462416995|gb|EMJ21732.1| hypothetical protein PRUPE_ppa002749mg [Prunus persica] Length = 638 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 334 NRMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSL 206 +R++FKDL+ AF SE +YLE QL RYM+ VG L+ERMVYSL Sbjct: 595 SRVKFKDLKFAFRPSERSYLEFQLRRYMRVVGEALAERMVYSL 637 >gb|EYU22341.1| hypothetical protein MIMGU_mgv1a003491mg [Mimulus guttatus] Length = 581 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 331 RMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSL 206 R RFKDL+ AF S +LESQ+ RY++AVG+ LSE+MVYSL Sbjct: 539 RRRFKDLRHAFNPSRRKFLESQIQRYVRAVGTELSEKMVYSL 580 >emb|CAN63217.1| hypothetical protein VITISV_033853 [Vitis vinifera] Length = 271 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 328 MRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMVYSLG 203 MRF+D+Q AFG E +LE+QL RYM+AVG+ ++ RMVYSLG Sbjct: 230 MRFQDMQHAFGLRERVWLETQLRRYMRAVGAEVAGRMVYSLG 271