BLASTX nr result
ID: Akebia23_contig00063632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00063632 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203209.1| hypothetical protein PRUPE_ppa000206mg [Prun... 55 1e-05 >ref|XP_007203209.1| hypothetical protein PRUPE_ppa000206mg [Prunus persica] gi|462398740|gb|EMJ04408.1| hypothetical protein PRUPE_ppa000206mg [Prunus persica] Length = 1469 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/81 (35%), Positives = 40/81 (49%) Frame = +1 Query: 4 QEAVSSVDHHNPQISSPIGCPSTQALGITGPFYTHIDHLQNIQDSFLPHQFIPAAHMAIT 183 QE ++ DH Q+ +G P+ LG P YT ++ H FIPA HM +T Sbjct: 490 QEVMNRADHL--QLPPQMGFPNAHLLGTASPVYTQQQFCDSVA-GITQHHFIPAVHMTMT 546 Query: 184 SSAPHVSMNPNVAPRFMHPHQ 246 S+ HV++ PNV M P Q Sbjct: 547 PSSSHVNIRPNVLQPLMQPQQ 567