BLASTX nr result
ID: Akebia23_contig00062901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062901 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44434.1| hypothetical protein DOTSEDRAFT_72045 [Dothistrom... 107 1e-21 ref|XP_003847948.1| hypothetical protein MYCGRDRAFT_77435 [Zymos... 107 2e-21 gb|EMC97619.1| hypothetical protein BAUCODRAFT_69206 [Baudoinia ... 107 2e-21 gb|EMF08601.1| hypothetical protein SEPMUDRAFT_152219 [Sphaeruli... 105 5e-21 gb|EME84262.1| hypothetical protein MYCFIDRAFT_214674 [Pseudocer... 103 2e-20 ref|XP_001821394.2| outer membrane protein porin [Aspergillus or... 80 3e-13 ref|XP_001267336.1| outer mitochondrial membrane protein porin [... 77 2e-12 ref|XP_662006.1| hypothetical protein AN4402.2 [Aspergillus nidu... 77 3e-12 gb|EMT63714.1| Mitochondrial outer membrane protein porin [Fusar... 76 4e-12 ref|XP_003649876.1| hypothetical protein THITE_2108942 [Thielavi... 76 6e-12 ref|XP_002144416.1| outer mitochondrial membrane protein porin [... 76 6e-12 ref|XP_002851216.1| outer mitochondrial membrane protein porin [... 75 7e-12 gb|EZF33785.1| mitochondrial outer membrane protein porin [Trich... 75 1e-11 gb|EZF22395.1| hypothetical protein H100_04839 [Trichophyton rub... 75 1e-11 ref|XP_003177798.1| outer mitochondrial membrane protein porin [... 75 1e-11 ref|XP_003020467.1| hypothetical protein TRV_05433 [Trichophyton... 75 1e-11 ref|XP_003011167.1| hypothetical protein ARB_02689 [Arthroderma ... 75 1e-11 ref|XP_002622715.1| outer mitochondrial membrane protein porin [... 75 1e-11 gb|EXJ86154.1| hypothetical protein A1O1_06524 [Capronia coronat... 75 1e-11 gb|ELR05669.1| mitochondrial outer membrane protein porin [Pseud... 75 1e-11 >gb|EME44434.1| hypothetical protein DOTSEDRAFT_72045 [Dothistroma septosporum NZE10] Length = 306 Score = 107 bits (268), Expect = 1e-21 Identities = 47/84 (55%), Positives = 64/84 (76%) Frame = -2 Query: 255 NVNVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQ 76 NVNVKGKQ FD T+ S+EGK+ KPQG+T+TQ W T +LLD+K+E AD ++ VK++LQ Sbjct: 59 NVNVKGKQGFDGVTSGSIEGKHTLKPQGVTITQSWNTGSLLDSKVELADVIAPGVKVDLQ 118 Query: 75 NLFNPNVPSKGAQKLNVSFKQPNL 4 NL+NP AQK+N++FK PN+ Sbjct: 119 NLWNPAKEGSAAQKVNLAFKNPNV 142 >ref|XP_003847948.1| hypothetical protein MYCGRDRAFT_77435 [Zymoseptoria tritici IPO323] gi|339467822|gb|EGP82924.1| hypothetical protein MYCGRDRAFT_77435 [Zymoseptoria tritici IPO323] Length = 303 Score = 107 bits (267), Expect = 2e-21 Identities = 48/83 (57%), Positives = 65/83 (78%) Frame = -2 Query: 252 VNVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQN 73 +NVKGKQ FD T+ SVEGK+ KPQGIT+TQ W+TA+LLD+K+E D ++ VK++LQN Sbjct: 57 LNVKGKQGFDGVTSGSVEGKHVLKPQGITITQAWSTASLLDSKVELNDVVADGVKVDLQN 116 Query: 72 LFNPNVPSKGAQKLNVSFKQPNL 4 L+NP+ AQKLN++FK PN+ Sbjct: 117 LWNPSKAGSAAQKLNLAFKNPNV 139 >gb|EMC97619.1| hypothetical protein BAUCODRAFT_69206 [Baudoinia compniacensis UAMH 10762] Length = 287 Score = 107 bits (266), Expect = 2e-21 Identities = 48/84 (57%), Positives = 64/84 (76%) Frame = -2 Query: 255 NVNVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQ 76 NV VKGKQ FD TT+ S+EGK+ KPQGITVTQ WTTA+LLD+K+E D + K++LQ Sbjct: 40 NVTVKGKQGFDGTTSGSIEGKHTLKPQGITVTQSWTTASLLDSKVELNDIGAPGAKIDLQ 99 Query: 75 NLFNPNVPSKGAQKLNVSFKQPNL 4 NL+NP+ + QK+N++FK PN+ Sbjct: 100 NLWNPSKGNSAVQKINLAFKNPNV 123 >gb|EMF08601.1| hypothetical protein SEPMUDRAFT_152219 [Sphaerulina musiva SO2202] Length = 306 Score = 105 bits (263), Expect = 5e-21 Identities = 45/84 (53%), Positives = 64/84 (76%) Frame = -2 Query: 255 NVNVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQ 76 NV +KGKQ FD T S+EGK+A KP G+T+TQ W+TA+LLD+K+E D ++ VK++LQ Sbjct: 59 NVTIKGKQGFDGVTAGSIEGKHAIKPHGVTITQAWSTASLLDSKVELTDAVAPGVKIDLQ 118 Query: 75 NLFNPNVPSKGAQKLNVSFKQPNL 4 NL+NP+ AQK+N++FK PN+ Sbjct: 119 NLWNPSKEGSAAQKVNLAFKNPNV 142 >gb|EME84262.1| hypothetical protein MYCFIDRAFT_214674 [Pseudocercospora fijiensis CIRAD86] Length = 371 Score = 103 bits (258), Expect = 2e-20 Identities = 45/84 (53%), Positives = 64/84 (76%) Frame = -2 Query: 255 NVNVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQ 76 NV VKGKQ FD T+ S+EGK++ KPQG+T+TQ WTTA+LLD+K+E D ++ VK+++Q Sbjct: 124 NVTVKGKQGFDGVTSGSIEGKHSLKPQGVTITQAWTTASLLDSKVELQDVVAPGVKVDVQ 183 Query: 75 NLFNPNVPSKGAQKLNVSFKQPNL 4 NL+NP QK+N++FK PN+ Sbjct: 184 NLWNPAKEGSANQKVNLAFKNPNV 207 >ref|XP_001821394.2| outer membrane protein porin [Aspergillus oryzae RIB40] gi|391869093|gb|EIT78298.1| porin/voltage-dependent anion-selective channel protein [Aspergillus oryzae 3.042] Length = 284 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/82 (48%), Positives = 54/82 (65%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + S+E KY KP G+T+TQ WTTA LDTK+E + ++ +K E+ Sbjct: 43 NVKGKNAHEGPIAGSLEAKYVDKPTGLTLTQAWTTANALDTKLELDNNIANGLKAEILTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P+ SKGA K+N+ FKQPNL Sbjct: 103 YQPSKQSKGA-KVNLHFKQPNL 123 >ref|XP_001267336.1| outer mitochondrial membrane protein porin [Neosartorya fischeri NRRL 181] gi|119415501|gb|EAW25439.1| outer mitochondrial membrane protein porin [Neosartorya fischeri NRRL 181] Length = 284 Score = 77.4 bits (189), Expect = 2e-12 Identities = 40/82 (48%), Positives = 54/82 (65%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + S+E KY P G+T+TQ WTTA LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGPIAGSLEAKYVDLPTGLTLTQAWTTANALDTKLELDNNIAKGLKAEILTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P+ SKGA KLN+ FKQPNL Sbjct: 103 YLPSKQSKGA-KLNLYFKQPNL 123 >ref|XP_662006.1| hypothetical protein AN4402.2 [Aspergillus nidulans FGSC A4] gi|40741129|gb|EAA60319.1| hypothetical protein AN4402.2 [Aspergillus nidulans FGSC A4] gi|259482787|tpe|CBF77600.1| TPA: outer mitochondrial membrane protein porin (AFU_orthologue; AFUA_4G06910) [Aspergillus nidulans FGSC A4] Length = 284 Score = 76.6 bits (187), Expect = 3e-12 Identities = 40/82 (48%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + S+E KY P G+T+TQ WTTA LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGPIAGSLEAKYVDAPTGLTLTQAWTTANALDTKLELDNNIAKGLKAEIITQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 103 YLPAKQSKGA-KLNLHFKQPNL 123 >gb|EMT63714.1| Mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. cubense race 4] gi|477509407|gb|ENH62699.1| Mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. cubense race 1] gi|517317521|emb|CCT68722.1| probable mitochondrial porin [Fusarium fujikuroi IMI 58289] gi|558866495|gb|ESU16578.1| hypothetical protein FGSG_09933 [Fusarium graminearum PH-1] gi|584130724|gb|EWG40118.1| mitochondrial outer membrane protein porin [Fusarium verticillioides 7600] gi|587668711|gb|EWY91052.1| mitochondrial outer membrane protein porin [Fusarium oxysporum FOSC 3-a] gi|587691063|gb|EWZ37668.1| mitochondrial outer membrane protein porin [Fusarium oxysporum Fo47] gi|587718331|gb|EWZ89668.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. lycopersici MN25] gi|587747544|gb|EXA45260.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. pisi HDV247] gi|590037864|gb|EXK39722.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. melonis 26406] gi|590063685|gb|EXK91209.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. raphani 54005] gi|591421989|gb|EXL57126.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452312|gb|EXL84615.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470066|gb|EXM01370.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503067|gb|EXM32412.1| mitochondrial outer membrane protein porin [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596540852|gb|EYB21601.1| hypothetical protein FG05_09933 [Fusarium graminearum] Length = 283 Score = 76.3 bits (186), Expect = 4e-12 Identities = 40/79 (50%), Positives = 53/79 (67%) Frame = -2 Query: 246 VKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNLF 67 V GK + + T+A++EGKY KP G+T+TQ W TA LDTKIE AD +++ +KLE F Sbjct: 43 VTGKSSHEKATSAAIEGKYTDKPTGLTLTQTWNTANALDTKIEVADSLAKGLKLEGLFNF 102 Query: 66 NPNVPSKGAQKLNVSFKQP 10 P +KGA K N+ FKQP Sbjct: 103 LPATAAKGA-KFNLHFKQP 120 >ref|XP_003649876.1| hypothetical protein THITE_2108942 [Thielavia terrestris NRRL 8126] gi|346997137|gb|AEO63540.1| hypothetical protein THITE_2108942 [Thielavia terrestris NRRL 8126] Length = 283 Score = 75.9 bits (185), Expect = 6e-12 Identities = 39/80 (48%), Positives = 53/80 (66%) Frame = -2 Query: 246 VKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNLF 67 V GK DS T+ ++EGKY KP G+T+TQ W TA +L+TKIEFAD +++ +K E F Sbjct: 43 VTGKSGHDSVTSGTIEGKYTDKPNGLTLTQTWNTANMLETKIEFADNLAKGLKAEGIFSF 102 Query: 66 NPNVPSKGAQKLNVSFKQPN 7 P ++GA K N+ FKQ N Sbjct: 103 LPATQARGA-KFNLHFKQSN 121 >ref|XP_002144416.1| outer mitochondrial membrane protein porin [Talaromyces marneffei ATCC 18224] gi|210073814|gb|EEA27901.1| outer mitochondrial membrane protein porin [Talaromyces marneffei ATCC 18224] Length = 284 Score = 75.9 bits (185), Expect = 6e-12 Identities = 40/81 (49%), Positives = 52/81 (64%) Frame = -2 Query: 246 VKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNLF 67 VKGK D S+E KY KP G+T+TQ WTTA LDTK+E + +++ +K E+ + Sbjct: 44 VKGKSTHDGPIGGSLEAKYVDKPIGLTLTQAWTTANALDTKLELDNNITKGLKAEILTQY 103 Query: 66 NPNVPSKGAQKLNVSFKQPNL 4 P SKGA KLN+ FKQPNL Sbjct: 104 LPTSQSKGA-KLNLYFKQPNL 123 >ref|XP_002851216.1| outer mitochondrial membrane protein porin [Arthroderma otae CBS 113480] gi|238838770|gb|EEQ28432.1| outer mitochondrial membrane protein porin [Arthroderma otae CBS 113480] Length = 284 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + + S+E KY P G+T+TQ WTT LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGSIAGSLEAKYVDAPSGLTLTQMWTTGNALDTKLELDNNITKGLKAEILTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 103 YIPYSQSKGA-KLNLHFKQPNL 123 >gb|EZF33785.1| mitochondrial outer membrane protein porin [Trichophyton interdigitale H6] Length = 345 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + + S+E KY P G+T+TQ WTT LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGSIAGSLEAKYVDAPSGLTLTQMWTTGNALDTKLELDNNITKGLKAEVLTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 103 YIPYSQSKGA-KLNLHFKQPNL 123 >gb|EZF22395.1| hypothetical protein H100_04839 [Trichophyton rubrum MR850] gi|607904098|gb|EZF41544.1| hypothetical protein H102_04823 [Trichophyton rubrum CBS 100081] gi|607916118|gb|EZF52116.1| hypothetical protein H103_04828 [Trichophyton rubrum CBS 288.86] gi|607928027|gb|EZF62580.1| hypothetical protein H104_04817 [Trichophyton rubrum CBS 289.86] gi|607939979|gb|EZF73229.1| hypothetical protein H105_04845 [Trichophyton soudanense CBS 452.61] gi|607952146|gb|EZF84021.1| hypothetical protein H110_04825 [Trichophyton rubrum MR1448] gi|607964242|gb|EZF94661.1| hypothetical protein H113_04867 [Trichophyton rubrum MR1459] gi|607971213|gb|EZG00656.1| hypothetical protein H106_08887 [Trichophyton rubrum CBS 735.88] gi|607988138|gb|EZG16128.1| hypothetical protein H107_04958 [Trichophyton rubrum CBS 202.88] Length = 254 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + + S+E KY P G+T+TQ WTT LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGSIAGSLEAKYVDAPSGLTLTQMWTTGNALDTKLELDNNITKGLKAEVLTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 103 YIPYSQSKGA-KLNLHFKQPNL 123 >ref|XP_003177798.1| outer mitochondrial membrane protein porin [Arthroderma gypseum CBS 118893] gi|311339644|gb|EFQ98846.1| outer mitochondrial membrane protein porin [Arthroderma gypseum CBS 118893] gi|607877249|gb|EZF22394.1| hypothetical protein H100_04839 [Trichophyton rubrum MR850] gi|607904097|gb|EZF41543.1| hypothetical protein H102_04823 [Trichophyton rubrum CBS 100081] gi|607916117|gb|EZF52115.1| hypothetical protein H103_04828 [Trichophyton rubrum CBS 288.86] gi|607928026|gb|EZF62579.1| hypothetical protein H104_04817 [Trichophyton rubrum CBS 289.86] gi|607939978|gb|EZF73228.1| hypothetical protein H105_04845 [Trichophyton soudanense CBS 452.61] gi|607952145|gb|EZF84020.1| hypothetical protein H110_04825 [Trichophyton rubrum MR1448] gi|607964241|gb|EZF94660.1| hypothetical protein H113_04867 [Trichophyton rubrum MR1459] gi|607971212|gb|EZG00655.1| hypothetical protein H106_08887 [Trichophyton rubrum CBS 735.88] gi|607988137|gb|EZG16127.1| hypothetical protein H107_04958 [Trichophyton rubrum CBS 202.88] Length = 284 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + + S+E KY P G+T+TQ WTT LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGSIAGSLEAKYVDAPSGLTLTQMWTTGNALDTKLELDNNITKGLKAEVLTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 103 YIPYSQSKGA-KLNLHFKQPNL 123 >ref|XP_003020467.1| hypothetical protein TRV_05433 [Trichophyton verrucosum HKI 0517] gi|291184304|gb|EFE39849.1| hypothetical protein TRV_05433 [Trichophyton verrucosum HKI 0517] Length = 315 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + + S+E KY P G+T+TQ WTT LDTK+E + +++ +K E+ Sbjct: 74 NVKGKSAHEGSIAGSLEAKYVDAPSGLTLTQMWTTGNALDTKLELDNNITKGLKAEVLTQ 133 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 134 YIPYSQSKGA-KLNLHFKQPNL 154 >ref|XP_003011167.1| hypothetical protein ARB_02689 [Arthroderma benhamiae CBS 112371] gi|291174715|gb|EFE30527.1| hypothetical protein ARB_02689 [Arthroderma benhamiae CBS 112371] Length = 315 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + + S+E KY P G+T+TQ WTT LDTK+E + +++ +K E+ Sbjct: 74 NVKGKSAHEGSIAGSLEAKYVDAPSGLTLTQMWTTGNALDTKLELDNNITKGLKAEVLTQ 133 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P SKGA KLN+ FKQPNL Sbjct: 134 YIPYSQSKGA-KLNLHFKQPNL 154 >ref|XP_002622715.1| outer mitochondrial membrane protein porin [Ajellomyces dermatitidis SLH14081] gi|239589197|gb|EEQ71840.1| outer mitochondrial membrane protein porin [Ajellomyces dermatitidis SLH14081] gi|239610269|gb|EEQ87256.1| outer mitochondrial membrane protein porin [Ajellomyces dermatitidis ER-3] gi|327357969|gb|EGE86826.1| outer mitochondrial membrane protein porin 1 [Ajellomyces dermatitidis ATCC 18188] gi|531979703|gb|EQL30290.1| mitochondrial outer membrane protein porin [Ajellomyces dermatitidis ATCC 26199] Length = 284 Score = 75.1 bits (183), Expect = 1e-11 Identities = 38/82 (46%), Positives = 54/82 (65%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A + S+E KY P G+T+TQ WTT+ LDTK+E + +++ +K E+ Sbjct: 43 NVKGKSAHEGPINGSLEAKYVDAPTGLTLTQTWTTSNSLDTKLELDNNIAKGLKAEILTQ 102 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P+ SKGA KLN+ FKQPN+ Sbjct: 103 YLPSSQSKGA-KLNLHFKQPNI 123 >gb|EXJ86154.1| hypothetical protein A1O1_06524 [Capronia coronata CBS 617.96] Length = 285 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/82 (46%), Positives = 54/82 (65%) Frame = -2 Query: 249 NVKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNL 70 NVKGK A D + S+EGKYA K G+T+TQ WTT+ LDTK+E D +++ +K E+ Sbjct: 44 NVKGKSAHDGPISGSIEGKYADKATGLTLTQTWTTSNSLDTKLELEDNLTKGLKAEVLTN 103 Query: 69 FNPNVPSKGAQKLNVSFKQPNL 4 + P + G KLN+ +KQPN+ Sbjct: 104 YLPAQSAYGG-KLNLFYKQPNI 124 >gb|ELR05669.1| mitochondrial outer membrane protein porin [Pseudogymnoascus destructans 20631-21] Length = 283 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/80 (47%), Positives = 52/80 (65%) Frame = -2 Query: 246 VKGKQAFDSTTTASVEGKYAYKPQGITVTQGWTTAALLDTKIEFADFMSQPVKLELQNLF 67 V GK + TTT ++E KY KP G+TVTQ W TA L++KIE D +++ +K E+ F Sbjct: 43 VNGKSTQEKTTTGALEAKYTDKPSGLTVTQTWNTANALESKIELNDNIAKGLKAEVLGNF 102 Query: 66 NPNVPSKGAQKLNVSFKQPN 7 P+ +KG KLN+ FKQPN Sbjct: 103 FPSTQAKGV-KLNLHFKQPN 121