BLASTX nr result
ID: Akebia23_contig00062619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062619 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533355.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_004234271.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006348045.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|XP_007152720.1| hypothetical protein PHAVU_004G153700g [Phas... 56 6e-06 >ref|XP_003533355.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 540 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 3 VPGCSMLEINGVVHEFSVRGSSEATMKEIEWILSGVSDEMKI 128 +PGCSM+EING V EFS GSSE MKE+ +L+G+S+EMKI Sbjct: 499 IPGCSMIEINGEVQEFSAGGSSELPMKELVLVLNGLSNEMKI 540 >ref|XP_004234271.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 551 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = +3 Query: 3 VPGCSMLEINGVVHEFSVRGSSEATMKEIEWILSGVSDEM 122 VPGCS +E+NGVV EFSVRGSS+ M EI+++LS +SDE+ Sbjct: 501 VPGCSAIEVNGVVCEFSVRGSSQVLMTEIKFVLSSLSDEI 540 >ref|XP_006348045.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 539 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 3 VPGCSMLEINGVVHEFSVRGSSEATMKEIEWILSGVSDEM 122 VPGCSM+E+NGVV EFSVRGS M EI+++LS +SDE+ Sbjct: 489 VPGCSMIEVNGVVCEFSVRGSPLVLMTEIKFVLSSLSDEI 528 >ref|XP_007152720.1| hypothetical protein PHAVU_004G153700g [Phaseolus vulgaris] gi|561026029|gb|ESW24714.1| hypothetical protein PHAVU_004G153700g [Phaseolus vulgaris] Length = 542 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 VPGCSMLEINGVVHEFSVRGSSEATMKEIEWILSGVSDEMKI 128 +PGCSM+EING V EFS GSSE MKE+ +L+ +S+EMKI Sbjct: 501 IPGCSMIEINGEVQEFSAGGSSELPMKELVLVLNRLSNEMKI 542