BLASTX nr result
ID: Akebia23_contig00062460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062460 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUC41265.1| hypothetical protein COCMIDRAFT_40521 [Bipolaris ... 58 2e-06 gb|EUN23082.1| hypothetical protein COCVIDRAFT_41208 [Bipolaris ... 57 3e-06 gb|EUC30746.1| hypothetical protein COCCADRAFT_28420 [Bipolaris ... 57 3e-06 gb|ENI09681.1| hypothetical protein COCC4DRAFT_46778 [Bipolaris ... 57 3e-06 gb|EMD90105.1| hypothetical protein COCHEDRAFT_1195380 [Bipolari... 57 3e-06 gb|EMD65329.1| hypothetical protein COCSADRAFT_158990 [Bipolaris... 57 3e-06 >gb|EUC41265.1| hypothetical protein COCMIDRAFT_40521 [Bipolaris oryzae ATCC 44560] Length = 436 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSHLANKADPRVDSDR G+ Sbjct: 124 YSDPTGPHDSHLANKADPRVDSDRVGT 150 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 67 YSDPTGPHDSHIANKADPRVDSDRVGT 93 >gb|EUN23082.1| hypothetical protein COCVIDRAFT_41208 [Bipolaris victoriae FI3] Length = 421 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 67 YSDPTGPHDSHMANKADPRVDSDRVGT 93 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 146 YSDPTGPHDSHMANKADPRVDSDRVGT 172 >gb|EUC30746.1| hypothetical protein COCCADRAFT_28420 [Bipolaris zeicola 26-R-13] Length = 354 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 67 YSDPTGPHDSHMANKADPRVDSDRVGT 93 >gb|ENI09681.1| hypothetical protein COCC4DRAFT_46778 [Bipolaris maydis ATCC 48331] Length = 362 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 57 YSDPTGPHDSHMANKADPRVDSDRVGT 83 >gb|EMD90105.1| hypothetical protein COCHEDRAFT_1195380 [Bipolaris maydis C5] Length = 394 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 57 YSDPTGPHDSHMANKADPRVDSDRVGT 83 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 158 YSDPTGPHDSHMANKADPRVDSDRVGT 184 >gb|EMD65329.1| hypothetical protein COCSADRAFT_158990 [Bipolaris sorokiniana ND90Pr] Length = 540 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 YSDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 220 YSDPTGPHDSHMANKADPRVDSDRVGT 246 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGSK-TVGSS 149 Y+DPTGPHDSH+ANKADPRVDSDR G+ +GSS Sbjct: 293 YNDPTGPHDSHMANKADPRVDSDRIGTAGNMGSS 326 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 247 YSDPTGPHDSHLANKADPRVDSDRDGS 167 +SDPTGPHDSH+ANKADPRVDSDR G+ Sbjct: 147 HSDPTGPHDSHMANKADPRVDSDRIGT 173