BLASTX nr result
ID: Akebia23_contig00062444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062444 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON62988.1| hypothetical protein W97_02214 [Coniosporium apol... 72 1e-10 ref|XP_001801229.1| hypothetical protein SNOG_10973 [Phaeosphaer... 71 1e-10 gb|EMD67274.1| hypothetical protein COCSADRAFT_44268, partial [B... 71 2e-10 gb|EUC46796.1| hypothetical protein COCMIDRAFT_46972, partial [B... 70 2e-10 gb|EUC36985.1| hypothetical protein COCCADRAFT_86941 [Bipolaris ... 70 2e-10 gb|EMD92362.1| hypothetical protein COCHEDRAFT_1079543, partial ... 70 2e-10 gb|EOA84186.1| hypothetical protein SETTUDRAFT_139052 [Setosphae... 69 7e-10 gb|EKG18970.1| hypothetical protein MPH_03787 [Macrophomina phas... 68 2e-09 ref|XP_003845055.1| predicted protein [Leptosphaeria maculans JN... 67 2e-09 ref|XP_001941308.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_007585664.1| hypothetical protein UCRNP2_6396 [Neofusicoc... 66 4e-09 ref|XP_003306078.1| hypothetical protein PTT_19105 [Pyrenophora ... 65 8e-09 >gb|EON62988.1| hypothetical protein W97_02214 [Coniosporium apollinis CBS 100218] Length = 85 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -1 Query: 309 AENESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 A++ VY+ G FSEPM++QHNF+N Y ++PQ+AMS Y RIMH HTK QL Sbjct: 4 AQHSGVYIHGGFSEPMSAQHNFSNQYSFDDPQEAMSVYKRIMHQHTKEQL 53 >ref|XP_001801229.1| hypothetical protein SNOG_10973 [Phaeosphaeria nodorum SN15] gi|111060352|gb|EAT81472.1| hypothetical protein SNOG_10973 [Phaeosphaeria nodorum SN15] Length = 85 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -1 Query: 312 MAEN-ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 M +N + VYV FSEPM++QHNF NN+D++NP AMS+Y RIMH HTK QL Sbjct: 4 MTQNRQQVYVSDGFSEPMSAQHNFANNFDLDNPDAAMSAYQRIMHEHTKRQL 55 >gb|EMD67274.1| hypothetical protein COCSADRAFT_44268, partial [Bipolaris sorokiniana ND90Pr] Length = 74 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 +SVYV FSEPM++QHNF NN+D+ +P++AMS Y RIMH HTK QL Sbjct: 9 QSVYVSDGFSEPMSTQHNFANNFDLNDPERAMSEYQRIMHEHTKRQL 55 >gb|EUC46796.1| hypothetical protein COCMIDRAFT_46972, partial [Bipolaris oryzae ATCC 44560] Length = 74 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 +SVYV FSEPM++QHNF NN+D+ +P++AMS Y RIMH HTK QL Sbjct: 9 QSVYVSEGFSEPMSAQHNFANNFDLNDPERAMSEYQRIMHEHTKRQL 55 >gb|EUC36985.1| hypothetical protein COCCADRAFT_86941 [Bipolaris zeicola 26-R-13] gi|578492799|gb|EUN30196.1| hypothetical protein COCVIDRAFT_35071 [Bipolaris victoriae FI3] Length = 78 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 +SVYV FSEPM +QHNF NN+D+ +P++AMS Y RIMH HTK QL Sbjct: 9 QSVYVSDGFSEPMGAQHNFANNFDLNDPERAMSEYQRIMHEHTKRQL 55 >gb|EMD92362.1| hypothetical protein COCHEDRAFT_1079543, partial [Bipolaris maydis C5] gi|477590980|gb|ENI08053.1| hypothetical protein COCC4DRAFT_114346, partial [Bipolaris maydis ATCC 48331] Length = 74 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 +SVYV FSEPM++QHNF NN+D+ +P++AMS Y RIMH HTK QL Sbjct: 9 QSVYVSEGFSEPMSAQHNFANNFDLNDPERAMSEYQRIMHEHTKRQL 55 >gb|EOA84186.1| hypothetical protein SETTUDRAFT_139052 [Setosphaeria turcica Et28A] Length = 79 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 + VYV FSEPM++QHNF NN+D+ +P++AMS Y RIMH HTK QL Sbjct: 9 QQVYVSQGFSEPMSAQHNFANNFDLNDPERAMSDYQRIMHEHTKRQL 55 >gb|EKG18970.1| hypothetical protein MPH_03787 [Macrophomina phaseolina MS6] Length = 85 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -1 Query: 294 VYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 VYV+ FS PM++QHNF N YD++NP Q+MS Y+R+MH HTK QL Sbjct: 8 VYVRDNFSAPMSAQHNFANQYDLDNPTQSMSIYSRVMHEHTKHQL 52 >ref|XP_003845055.1| predicted protein [Leptosphaeria maculans JN3] gi|312221636|emb|CBY01576.1| predicted protein [Leptosphaeria maculans JN3] Length = 173 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 + VYV FSEPM++QHNF NN+D+ +P+ AM++Y +IMH HTK QL Sbjct: 102 QQVYVSDDFSEPMSAQHNFANNFDLNDPESAMTAYQKIMHEHTKRQL 148 >ref|XP_001941308.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977401|gb|EDU44027.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 80 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 + VYV FSEPM++QHNF N++D+ +P +AMS Y RIMH HTK QL Sbjct: 9 QQVYVSDGFSEPMSAQHNFANHFDLNDPDRAMSEYQRIMHEHTKRQL 55 >ref|XP_007585664.1| hypothetical protein UCRNP2_6396 [Neofusicoccum parvum UCRNP2] gi|485921049|gb|EOD46867.1| hypothetical protein UCRNP2_6396 [Neofusicoccum parvum UCRNP2] Length = 85 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -1 Query: 294 VYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 VYV+ +S PM++QHNFTN YD++NP +MS Y+R+MH HTK QL Sbjct: 8 VYVRDNYSAPMSAQHNFTNQYDLDNPTASMSIYSRVMHEHTKHQL 52 >ref|XP_003306078.1| hypothetical protein PTT_19105 [Pyrenophora teres f. teres 0-1] gi|311316603|gb|EFQ85824.1| hypothetical protein PTT_19105 [Pyrenophora teres f. teres 0-1] Length = 80 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = -1 Query: 300 ESVYVQGTFSEPMASQHNFTNNYDVENPQQAMSSYARIMHNHTKAQL 160 + VYV FSEPM++QHNF N++D+ +P +AM+ Y RIMH HTK QL Sbjct: 9 QQVYVSDGFSEPMSAQHNFANHFDLNDPDRAMTEYQRIMHEHTKRQL 55