BLASTX nr result
ID: Akebia23_contig00062428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062428 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535172.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002535172.1| conserved hypothetical protein [Ricinus communis] gi|223523836|gb|EEF27212.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 262 IYKSNGKRIADTLTAFETLKYNPSGLTPGADPNRK 158 IYKSNG R+ADTLTAF+T KYNPSGLTP P K Sbjct: 34 IYKSNGIRMADTLTAFDTKKYNPSGLTPPGGPQPK 68