BLASTX nr result
ID: Akebia23_contig00062129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00062129 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS73672.1| hypothetical protein PFICI_14618 [Pestalotiopsis ... 62 1e-07 >gb|ETS73672.1| hypothetical protein PFICI_14618 [Pestalotiopsis fici W106-1] Length = 435 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +2 Query: 158 MQSLMKVLFLLGLVALATAAPG-QIQKRGVYKVERVANPNYT 280 MQSLMKVLFL+ LVAL A+P +IQKRGVYKVERV+NP YT Sbjct: 1 MQSLMKVLFLMALVALVAASPAPKIQKRGVYKVERVSNPAYT 42