BLASTX nr result
ID: Akebia23_contig00061426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00061426 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC95303.1| hypothetical protein BAUCODRAFT_534401 [Baudoinia... 55 8e-06 >gb|EMC95303.1| hypothetical protein BAUCODRAFT_534401 [Baudoinia compniacensis UAMH 10762] Length = 354 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = -1 Query: 205 SAPHDTTAANRLDPNVSADGHL-STGPGVGAQDTSHVHKEGLEHIKGQLD 59 S PH T A N DP V ADG L STG GVG D + +EGLEHI+ +D Sbjct: 18 SGPHPTLAGNMFDPGVKADGKLGSTGTGVGGTDEQAIRQEGLEHIRSHVD 67