BLASTX nr result
ID: Akebia23_contig00061076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00061076 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ61257.1| hypothetical protein A1O5_12049 [Cladophialophora... 56 6e-06 gb|EON68389.1| hypothetical protein W97_07647 [Coniosporium apol... 55 8e-06 >gb|EXJ61257.1| hypothetical protein A1O5_12049 [Cladophialophora psammophila CBS 110553] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +1 Query: 4 LRSSDMEMMVQFNALEREACDWENLIKKADPRLRIQSIYKPARSANS 144 +R D+EMM FNA ERE DW +L +ADPRL+I ++ KP S NS Sbjct: 368 IRVMDLEMMTNFNAKERELDDWRSLFSRADPRLKIANVIKPLGSVNS 414 >gb|EON68389.1| hypothetical protein W97_07647 [Coniosporium apollinis CBS 100218] Length = 427 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = +1 Query: 4 LRSSDMEMMVQFNALEREACDWENLIKKADPRLRIQSIYKPARSANS 144 +R DMEMM FNA ERE DW L K+DPRL+++++ KP+ S NS Sbjct: 369 IRIMDMEMMTTFNAREREIEDWRALFTKSDPRLKLRNVVKPSGSVNS 415