BLASTX nr result
ID: Akebia23_contig00060441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00060441 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR61552.1| putative 60s ribosomal protein l35 protein [Eutyp... 101 1e-19 gb|EJP69617.1| putative ribosomal protein L35 [Beauveria bassian... 99 6e-19 gb|AET13874.1| 60S ribosomal protein L35 [Neotyphodium lolii] 98 1e-18 gb|EFZ00295.1| 60S ribosomal protein L35 [Metarhizium anisopliae... 97 2e-18 gb|EFY86863.1| 60S ribosomal protein L35 [Metarhizium acridum CQ... 97 2e-18 gb|EGU87308.1| hypothetical protein FOXB_02184 [Fusarium oxyspor... 97 3e-18 ref|XP_001905045.1| hypothetical protein [Podospora anserina S m... 96 4e-18 gb|EHK49989.1| hypothetical protein TRIATDRAFT_297358 [Trichoder... 96 5e-18 ref|XP_006671106.1| 60S ribosomal protein L35 [Cordyceps militar... 96 5e-18 ref|XP_006962762.1| 60S ribosomal protein L35, L29 family [Trich... 96 7e-18 gb|EMT62102.1| 60S ribosomal protein L35 [Fusarium oxysporum f. ... 95 9e-18 ref|XP_003652044.1| 60S ribosomal protein L35 [Thielavia terrest... 95 9e-18 gb|ELR09364.1| 60S ribosomal protein L35 [Pseudogymnoascus destr... 95 1e-17 ref|XP_003054227.1| 60S ribosomal protein L35 [Nectria haematoco... 95 1e-17 gb|EPE31577.1| Ribosomal protein L29 (L29p) [Glarea lozoyensis A... 94 2e-17 gb|EOO02051.1| putative 60s ribosomal protein l35 protein [Togni... 94 2e-17 ref|XP_003659547.1| hypothetical protein MYCTH_77277 [Myceliopht... 94 2e-17 emb|CCE34060.1| probable ribosomal protein L35 [Claviceps purpur... 93 3e-17 ref|XP_381197.1| hypothetical protein FG01021.1 [Fusarium gramin... 93 3e-17 ref|XP_007293801.1| 60S ribosomal protein L35 [Marssonina brunne... 93 4e-17 >gb|EMR61552.1| putative 60s ribosomal protein l35 protein [Eutypa lata UCREL1] Length = 198 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRLSP +K++TLEKTKKR THFPQRKYAVKA Sbjct: 143 RLFYKNKKYLPLDLRPKQTRAIRRRLSPEEKSQTLEKTKKRQTHFPQRKYAVKA 196 >gb|EJP69617.1| putative ribosomal protein L35 [Beauveria bassiana ARSEF 2860] Length = 125 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRLSP DKA+ LEK KKR THFPQRK+A+KA Sbjct: 72 RLFYKNKKYAPLDLRPKQTRAIRRRLSPEDKARVLEKAKKRETHFPQRKFAIKA 125 >gb|AET13874.1| 60S ribosomal protein L35 [Neotyphodium lolii] Length = 124 Score = 97.8 bits (242), Expect = 1e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP DKA+ LEKTKKR THFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRVKQTRAIRRRLSPEDKARVLEKTKKRTTHFPQRKFAIKA 124 >gb|EFZ00295.1| 60S ribosomal protein L35 [Metarhizium anisopliae ARSEF 23] gi|594719872|gb|EXV02761.1| ribosomal protein L29 [Metarhizium robertsii] Length = 124 Score = 97.1 bits (240), Expect = 2e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP DKA+ LEKTKKR THFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRVKQTRAIRRRLSPEDKARALEKTKKRNTHFPQRKFAIKA 124 >gb|EFY86863.1| 60S ribosomal protein L35 [Metarhizium acridum CQMa 102] Length = 124 Score = 97.1 bits (240), Expect = 2e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP DKA+ LEKTKKR THFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRVKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKA 124 >gb|EGU87308.1| hypothetical protein FOXB_02184 [Fusarium oxysporum Fo5176] gi|517310862|emb|CCT63477.1| probable ribosomal protein L35 [Fusarium fujikuroi IMI 58289] gi|584128158|gb|EWG37577.1| 60S ribosomal protein L35 [Fusarium verticillioides 7600] gi|587671756|gb|EWY94097.1| 60S ribosomal protein L35 [Fusarium oxysporum FOSC 3-a] gi|587704008|gb|EWZ50613.1| 60S ribosomal protein L35 [Fusarium oxysporum Fo47] gi|587720590|gb|EWZ91927.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587755470|gb|EXA53186.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. pisi HDV247] gi|590045991|gb|EXK47849.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. melonis 26406] gi|590062230|gb|EXK89754.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. raphani 54005] gi|591414398|gb|EXL49535.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591448348|gb|EXL80758.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591479956|gb|EXM11016.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591494749|gb|EXM24297.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 124 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRLSP +K++ LEKTKKR HFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRPKQTRAIRRRLSPEEKSRVLEKTKKRTVHFPQRKFAIKA 124 >ref|XP_001905045.1| hypothetical protein [Podospora anserina S mat+] gi|170939726|emb|CAP64952.1| unnamed protein product [Podospora anserina S mat+] Length = 124 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP D ++TLEKTKKR THFPQRK+AVKA Sbjct: 71 RLFYKNKKYLPLDLRAKQTRAIRRRLSPEDASRTLEKTKKRQTHFPQRKFAVKA 124 >gb|EHK49989.1| hypothetical protein TRIATDRAFT_297358 [Trichoderma atroviride IMI 206040] Length = 124 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYK KY PLDLRPKQTRAIRRRLSP DKA+ LEKTKKR THFPQRK+A+KA Sbjct: 71 RLFYKKSKYLPLDLRPKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKA 124 >ref|XP_006671106.1| 60S ribosomal protein L35 [Cordyceps militaris CM01] gi|346322142|gb|EGX91741.1| 60S ribosomal protein L35 [Cordyceps militaris CM01] Length = 124 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRLSP DKA+ L+K KR THFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRPKQTRAIRRRLSPEDKARVLQKASKRETHFPQRKFAIKA 124 >ref|XP_006962762.1| 60S ribosomal protein L35, L29 family [Trichoderma reesei QM6a] gi|340521000|gb|EGR51235.1| 60S ribosomal protein L35, L29 family [Trichoderma reesei QM6a] gi|358379841|gb|EHK17520.1| hypothetical protein TRIVIDRAFT_75969 [Trichoderma virens Gv29-8] gi|572281399|gb|ETS04423.1| 60S ribosomal protein L35 [Trichoderma reesei RUT C-30] Length = 124 Score = 95.5 bits (236), Expect = 7e-18 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYK KY PLDLRPKQTRAIRRRLSP DKA+ LEKTKKR THFPQRK+A+KA Sbjct: 71 RLFYKKAKYLPLDLRPKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKA 124 >gb|EMT62102.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. cubense race 4] gi|477507563|gb|ENH60857.1| 60S ribosomal protein L35 [Fusarium oxysporum f. sp. cubense race 1] Length = 125 Score = 95.1 bits (235), Expect = 9e-18 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVK 161 RLFYKNKKY PLDLRPKQTRAIRRRLSP +K++ LEKTKKR HFPQRK+A+K Sbjct: 71 RLFYKNKKYAPLDLRPKQTRAIRRRLSPEEKSRVLEKTKKRTVHFPQRKFAIK 123 >ref|XP_003652044.1| 60S ribosomal protein L35 [Thielavia terrestris NRRL 8126] gi|346999306|gb|AEO65708.1| hypothetical protein THITE_2112976 [Thielavia terrestris NRRL 8126] Length = 125 Score = 95.1 bits (235), Expect = 9e-18 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYK KKY PLDLRPKQTRAIRRRLSP D ++ LEKTKKR THFPQRK+AVKA Sbjct: 71 RLFYKGKKYLPLDLRPKQTRAIRRRLSPEDASRVLEKTKKRQTHFPQRKFAVKA 124 >gb|ELR09364.1| 60S ribosomal protein L35 [Pseudogymnoascus destructans 20631-21] Length = 125 Score = 94.7 bits (234), Expect = 1e-17 Identities = 46/54 (85%), Positives = 47/54 (87%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRLS D A+ LEKT KR THFPQRKYAVKA Sbjct: 72 RLFYKNKKYLPLDLRPKQTRAIRRRLSKEDSARVLEKTTKRNTHFPQRKYAVKA 125 >ref|XP_003054227.1| 60S ribosomal protein L35 [Nectria haematococca mpVI 77-13-4] gi|256735168|gb|EEU48514.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 124 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRLSP +K++ LEK KKR+ HFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRPKQTRAIRRRLSPDEKSRVLEKAKKRSVHFPQRKFAIKA 124 >gb|EPE31577.1| Ribosomal protein L29 (L29p) [Glarea lozoyensis ATCC 20868] Length = 129 Score = 94.4 bits (233), Expect = 2e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYK KKYTPLDLRPKQTRAIRRRL+ + KTLEKTKKR+ HFPQRKYA+KA Sbjct: 74 RLFYKGKKYTPLDLRPKQTRAIRRRLTKNESGKTLEKTKKRSVHFPQRKYAIKA 127 >gb|EOO02051.1| putative 60s ribosomal protein l35 protein [Togninia minima UCRPA7] Length = 126 Score = 94.4 bits (233), Expect = 2e-17 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP D ++ LEKTKKR THFPQRK+AVKA Sbjct: 71 RLFYKNKKYLPLDLRSKQTRAIRRRLSPEDASRVLEKTKKRQTHFPQRKFAVKA 124 >ref|XP_003659547.1| hypothetical protein MYCTH_77277 [Myceliophthora thermophila ATCC 42464] gi|347006814|gb|AEO54302.1| hypothetical protein MYCTH_77277 [Myceliophthora thermophila ATCC 42464] Length = 125 Score = 94.4 bits (233), Expect = 2e-17 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP D ++ LEKTKKR THFPQRK+AVKA Sbjct: 71 RLFYKNKKYLPLDLRAKQTRAIRRRLSPEDASRVLEKTKKRQTHFPQRKFAVKA 124 >emb|CCE34060.1| probable ribosomal protein L35 [Claviceps purpurea 20.1] Length = 167 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP DKA+ L KT+KR THFPQRK+A+KA Sbjct: 102 RLFYKNKKYAPLDLRAKQTRAIRRRLSPEDKARVLLKTQKRITHFPQRKFAIKA 155 >ref|XP_381197.1| hypothetical protein FG01021.1 [Fusarium graminearum PH-1] gi|46396937|sp|Q8L805.1|RL35_WHEAT RecName: Full=60S ribosomal protein L35 gi|110590378|pdb|2GO5|5 Chain 5, Structure Of Signal Recognition Particle Receptor (Sr) In Complex With Signal Recognition Particle (Srp) And Ribosome Nascent Chain Complex gi|119390382|pdb|2J37|5 Chain 5, Model Of Mammalian Srp Bound To 80s Rncs gi|582044924|pdb|3J61|HH Chain h, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|22204122|gb|AAM92709.1| putative ribosomal protein L35 [Triticum aestivum] gi|558856207|gb|ESU06290.1| hypothetical protein FGSG_01021 [Fusarium graminearum PH-1] Length = 124 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLR KQTRAIRRRLSP +K++ LEKTKKR HFPQRK+A+KA Sbjct: 71 RLFYKNKKYAPLDLRAKQTRAIRRRLSPDEKSRVLEKTKKRTVHFPQRKFAIKA 124 >ref|XP_007293801.1| 60S ribosomal protein L35 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862852|gb|EKD15901.1| 60S ribosomal protein L35 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 127 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 3 RLFYKNKKYTPLDLRPKQTRAIRRRLSPADKAKTLEKTKKRATHFPQRKYAVKA 164 RLFYKNKKY PLDLRPKQTRAIRRRL+ ++ TLEK KKRATHFPQRKYA+KA Sbjct: 72 RLFYKNKKYLPLDLRPKQTRAIRRRLTKHEQEMTLEKQKKRATHFPQRKYAIKA 125