BLASTX nr result
ID: Akebia23_contig00060385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00060385 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356764.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 >ref|XP_006356764.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Solanum tuberosum] Length = 699 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/68 (60%), Positives = 52/68 (76%) Frame = +1 Query: 31 MNWHARFLKLGLDTNPIFATRLLNAYVTSHGPNSLTYAHQLFDQVPFKDTTLWTSIISAC 210 M+ HA +KLGLDT+P++AT L+ YV+S PNSLT A ++FDQVP KDTTLWTS+IS+ Sbjct: 1 MSKHAWLIKLGLDTSPLYATNLIAHYVSSPIPNSLTIAQKVFDQVPHKDTTLWTSLISSY 60 Query: 211 TRSGNPQK 234 RS P K Sbjct: 61 ARSNQPHK 68