BLASTX nr result
ID: Akebia23_contig00060211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00060211 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris ... 76 5e-12 gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris z... 76 5e-12 gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolari... 76 5e-12 gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris... 76 5e-12 gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaer... 72 8e-11 ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres... 71 2e-10 ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora triti... 71 2e-10 gb|EEH11334.1| 60S ribosomal protein L20 [Ajellomyces capsulatus... 69 9e-10 ref|XP_001541495.1| 60S ribosomal protein L20 [Ajellomyces capsu... 69 9e-10 gb|EEQ86274.1| 60S ribosomal protein L18A [Ajellomyces dermatiti... 68 1e-09 ref|XP_002620561.1| 60S ribosomal protein L18A [Ajellomyces derm... 68 1e-09 gb|EEH47789.1| 60S ribosomal protein L20 [Paracoccidioides brasi... 68 1e-09 ref|XP_002797093.1| 60S ribosomal protein L20 [Paracoccidioides ... 68 1e-09 ref|XP_001801850.1| hypothetical protein SNOG_11611 [Phaeosphaer... 68 1e-09 gb|EON69026.1| 60S ribosomal protein L20 [Coniosporium apollinis... 67 2e-09 ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Lepto... 67 2e-09 ref|XP_002583653.1| 60S ribosomal protein L20 [Uncinocarpus rees... 67 2e-09 gb|EPE30763.1| 60S ribosomal protein L20 [Glarea lozoyensis ATCC... 66 6e-09 gb|EHK96283.1| putative 60S ribosomal protein L20-B [Glarea lozo... 66 6e-09 ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunne... 65 7e-09 >gb|EUC46000.1| hypothetical protein COCMIDRAFT_94025 [Bipolaris oryzae ATCC 44560] Length = 190 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVFAAHRP+TFF Sbjct: 153 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >gb|EUC27801.1| hypothetical protein COCCADRAFT_9694 [Bipolaris zeicola 26-R-13] gi|578485853|gb|EUN23340.1| hypothetical protein COCVIDRAFT_29773 [Bipolaris victoriae FI3] Length = 191 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVFAAHRP+TFF Sbjct: 154 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 191 >gb|EMD87012.1| hypothetical protein COCHEDRAFT_1227999 [Bipolaris maydis C5] gi|477586910|gb|ENI03993.1| hypothetical protein COCC4DRAFT_198673 [Bipolaris maydis ATCC 48331] Length = 205 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVFAAHRP+TFF Sbjct: 168 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 205 >gb|EMD59734.1| hypothetical protein COCSADRAFT_203472 [Bipolaris sorokiniana ND90Pr] Length = 190 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVFAAHRP+TFF Sbjct: 153 RPYIKQLLTKNLKFPLPHRINKKAGKKVFAAHRPSTFF 190 >gb|EOA91377.1| hypothetical protein SETTUDRAFT_29919 [Setosphaeria turcica Et28A] Length = 173 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVF+A+RP+TFF Sbjct: 136 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSANRPSTFF 173 >ref|XP_003297118.1| 60S ribosomal protein L20 [Pyrenophora teres f. teres 0-1] gi|311330357|gb|EFQ94776.1| hypothetical protein PTT_07431 [Pyrenophora teres f. teres 0-1] Length = 175 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVF+A RP+TFF Sbjct: 138 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 175 >ref|XP_001935145.1| 60S ribosomal protein L20 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981093|gb|EDU47719.1| 60S ribosomal protein L18ae [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 174 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHRI K AGKKVF+A RP+TFF Sbjct: 137 RPYIKQLLTKNLKFPLPHRINKKAGKKVFSATRPSTFF 174 >gb|EEH11334.1| 60S ribosomal protein L20 [Ajellomyces capsulatus G186AR] Length = 231 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQL+TKNLKFPLPHR+PK + KK+FAA RP+TF Sbjct: 194 RPYIKQLITKNLKFPLPHRVPKASTKKIFAAQRPSTF 230 >ref|XP_001541495.1| 60S ribosomal protein L20 [Ajellomyces capsulatus NAm1] gi|150411674|gb|EDN07062.1| 60S ribosomal protein L18A [Ajellomyces capsulatus NAm1] gi|240279872|gb|EER43377.1| ribosomal L18ae protein family [Ajellomyces capsulatus H143] gi|325093003|gb|EGC46313.1| ribosomal L18ae protein family [Ajellomyces capsulatus H88] Length = 174 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQL+TKNLKFPLPHR+PK + KK+FAA RP+TF Sbjct: 137 RPYIKQLITKNLKFPLPHRVPKASTKKIFAAQRPSTF 173 >gb|EEQ86274.1| 60S ribosomal protein L18A [Ajellomyces dermatitidis ER-3] gi|327357313|gb|EGE86170.1| 60S ribosomal protein L20 [Ajellomyces dermatitidis ATCC 18188] gi|531977607|gb|EQL28194.1| 60S ribosomal protein L20 [Ajellomyces dermatitidis ATCC 26199] Length = 174 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQLLTKNLKFPLPHR+PK KK+FAA RP+TF Sbjct: 137 RPYIKQLLTKNLKFPLPHRVPKATTKKLFAAQRPSTF 173 >ref|XP_002620561.1| 60S ribosomal protein L18A [Ajellomyces dermatitidis SLH14081] gi|239593308|gb|EEQ75889.1| 60S ribosomal protein L18A [Ajellomyces dermatitidis SLH14081] Length = 105 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQLLTKNLKFPLPHR+PK KK+FAA RP+TF Sbjct: 68 RPYIKQLLTKNLKFPLPHRVPKATTKKLFAAQRPSTF 104 >gb|EEH47789.1| 60S ribosomal protein L20 [Paracoccidioides brasiliensis Pb18] Length = 174 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQLLTKNLKFPLPHR+PK KK+FAA RP+TF Sbjct: 137 RPYIKQLLTKNLKFPLPHRVPKATTKKLFAARRPSTF 173 >ref|XP_002797093.1| 60S ribosomal protein L20 [Paracoccidioides sp. 'lutzii' Pb01] gi|226282465|gb|EEH38031.1| 60S ribosomal protein L20 [Paracoccidioides sp. 'lutzii' Pb01] Length = 174 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQLLTKNLKFPLPHR+PK KK+FAA RP+TF Sbjct: 137 RPYIKQLLTKNLKFPLPHRVPKATTKKLFAARRPSTF 173 >ref|XP_001801850.1| hypothetical protein SNOG_11611 [Phaeosphaeria nodorum SN15] gi|160703278|gb|EAT81319.2| hypothetical protein SNOG_11611 [Phaeosphaeria nodorum SN15] Length = 174 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLL K LKFPLPHRI K AGKKVFAA RP+TFF Sbjct: 137 RPYIKQLLVKGLKFPLPHRINKKAGKKVFAAKRPSTFF 174 >gb|EON69026.1| 60S ribosomal protein L20 [Coniosporium apollinis CBS 100218] Length = 183 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLT LKFPLPHR+PK A KK+FAA+RP+TF+ Sbjct: 146 RPYIKQLLTPKLKFPLPHRVPKAATKKIFAANRPSTFY 183 >ref|XP_003841410.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans JN3] gi|312217984|emb|CBX97931.1| similar to 60S ribosomal protein L18a [Leptosphaeria maculans JN3] Length = 182 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLL KNLKFPLPHRI K AGKK+F++ RP+TFF Sbjct: 145 RPYIKQLLVKNLKFPLPHRINKKAGKKIFSSTRPSTFF 182 >ref|XP_002583653.1| 60S ribosomal protein L20 [Uncinocarpus reesii 1704] gi|237907354|gb|EEP81755.1| 60S ribosomal protein L20 [Uncinocarpus reesii 1704] Length = 151 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATF 113 RPYIKQLLTKNLKFPLPHRI K GK+VFAA RP+TF Sbjct: 114 RPYIKQLLTKNLKFPLPHRIAKPQGKRVFAASRPSTF 150 >gb|EPE30763.1| 60S ribosomal protein L20 [Glarea lozoyensis ATCC 20868] Length = 184 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHR+ K AG K+F RP+TF+ Sbjct: 147 RPYIKQLLTKNLKFPLPHRVSKAAGTKIFVGKRPSTFY 184 >gb|EHK96283.1| putative 60S ribosomal protein L20-B [Glarea lozoyensis 74030] Length = 231 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTKNLKFPLPHR+ K AG K+F RP+TF+ Sbjct: 194 RPYIKQLLTKNLKFPLPHRVSKAAGTKIFVGKRPSTFY 231 >ref|XP_007297620.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406859021|gb|EKD12094.1| 60S ribosomal protein L20 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 242 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 3 RPYIKQLLTKNLKFPLPHRIPKTAGKKVFAAHRPATFF 116 RPYIKQLLTK+LKFPLPHR+ K+ GKK+F+ RP+TF+ Sbjct: 205 RPYIKQLLTKDLKFPLPHRVSKSTGKKIFSGSRPSTFY 242