BLASTX nr result
ID: Akebia23_contig00059600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00059600 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45253.1| hypothetical protein DOTSEDRAFT_71080 [Dothistrom... 85 9e-15 ref|XP_002791399.1| 60S ribosomal protein L43 [Paracoccidioides ... 84 2e-14 gb|EEQ84404.1| 60S ribosomal protein L43 [Ajellomyces dermatitid... 83 3e-14 ref|XP_002626634.1| 60S ribosomal protein L43 [Ajellomyces derma... 83 3e-14 gb|EXJ66530.1| ribosomal protein L37ae [Cladophialophora psammop... 83 4e-14 gb|EXJ61557.1| ribosomal protein L37ae [Cladophialophora yegresi... 83 4e-14 gb|ETI27117.1| 60S ribosomal protein L43 [Cladophialophora carri... 83 4e-14 gb|EMF13193.1| 60S ribosomal protein L37a [Sphaerulina musiva SO... 83 4e-14 gb|EXJ76849.1| ribosomal protein L37ae [Capronia epimyces CBS 60... 82 6e-14 gb|EHY56296.1| ribosomal protein L37ae [Exophiala dermatitidis N... 82 6e-14 gb|ETN43164.1| 60S ribosomal protein L37a [Cyphellophora europae... 82 1e-13 gb|EGD97515.1| 60S ribosomal protein L37a [Trichophyton tonsuran... 82 1e-13 ref|XP_003170511.1| 60S ribosomal protein L43 [Arthroderma gypse... 82 1e-13 ref|XP_002848386.1| 60S ribosomal protein L43 [Arthroderma otae ... 82 1e-13 gb|EME84721.1| hypothetical protein MYCFIDRAFT_88568 [Pseudocerc... 81 2e-13 ref|XP_002836190.1| 60S ribosomal protein L43 [Tuber melanosporu... 81 2e-13 ref|XP_001935731.1| 60S ribosomal protein L43 [Pyrenophora triti... 81 2e-13 ref|XP_001538929.1| 60S ribosomal protein L43 [Ajellomyces capsu... 81 2e-13 gb|ERT02009.1| ribosomal protein L37a [Sporothrix schenckii ATCC... 80 2e-13 emb|CCX12531.1| Similar to 60S ribosomal protein L43; acc. no. Q... 80 2e-13 >gb|EME45253.1| hypothetical protein DOTSEDRAFT_71080 [Dothistroma septosporum NZE10] Length = 92 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR+ VGIWDCK+CGKTVAGGA+TVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRNAVGIWDCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_002791399.1| 60S ribosomal protein L43 [Paracoccidioides sp. 'lutzii' Pb01] gi|225682051|gb|EEH20335.1| 60S ribosomal protein L43 [Paracoccidioides brasiliensis Pb03] gi|226279956|gb|EEH35522.1| 60S ribosomal protein L43 [Paracoccidioides sp. 'lutzii' Pb01] gi|226289225|gb|EEH44737.1| 60S ribosomal protein L43 [Paracoccidioides brasiliensis Pb18] Length = 92 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW+C++C KTVAGGAWTVSTPAAATTRSTIRRLRE+AEV Sbjct: 47 VKRKAVGIWECRSCKKTVAGGAWTVSTPAAATTRSTIRRLREIAEV 92 >gb|EEQ84404.1| 60S ribosomal protein L43 [Ajellomyces dermatitidis ER-3] gi|327352404|gb|EGE81261.1| hypothetical protein BDDG_04202 [Ajellomyces dermatitidis ATCC 18188] gi|531986334|gb|EQL36921.1| large subunit ribosomal protein L37Ae [Ajellomyces dermatitidis ATCC 26199] Length = 148 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW+C++C K VAGGAWTVSTPAAATTRSTIRRLRE+AEV Sbjct: 103 VKRKAVGIWECRSCSKVVAGGAWTVSTPAAATTRSTIRRLREIAEV 148 >ref|XP_002626634.1| 60S ribosomal protein L43 [Ajellomyces dermatitidis SLH14081] gi|239593706|gb|EEQ76287.1| 60S ribosomal protein L43 [Ajellomyces dermatitidis SLH14081] Length = 148 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW+C++C K VAGGAWTVSTPAAATTRSTIRRLRE+AEV Sbjct: 103 VKRKAVGIWECRSCSKVVAGGAWTVSTPAAATTRSTIRRLREIAEV 148 >gb|EXJ66530.1| ribosomal protein L37ae [Cladophialophora psammophila CBS 110553] Length = 92 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW+CK C KTVAGGAWTVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRQAVGIWNCKGCKKTVAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >gb|EXJ61557.1| ribosomal protein L37ae [Cladophialophora yegresii CBS 114405] Length = 92 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW CK C KTVAGGAWTVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRQAVGIWKCKGCNKTVAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >gb|ETI27117.1| 60S ribosomal protein L43 [Cladophialophora carrionii CBS 160.54] Length = 92 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW CK C KTVAGGAWTVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRQAVGIWKCKGCNKTVAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >gb|EMF13193.1| 60S ribosomal protein L37a [Sphaerulina musiva SO2202] Length = 92 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIWDC++CGKTVAGGA+TVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRVAVGIWDCRSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EXJ76849.1| ribosomal protein L37ae [Capronia epimyces CBS 606.96] Length = 92 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR +VGIW CK C KT+AGGAWTVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRHSVGIWKCKGCKKTIAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >gb|EHY56296.1| ribosomal protein L37ae [Exophiala dermatitidis NIH/UT8656] Length = 92 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR +VGIW CK C KT+AGGAWTVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRHSVGIWKCKGCQKTIAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >gb|ETN43164.1| 60S ribosomal protein L37a [Cyphellophora europaea CBS 101466] Length = 92 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW C+ C KTVAGGAWTVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRQAVGIWKCRGCNKTVAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >gb|EGD97515.1| 60S ribosomal protein L37a [Trichophyton tonsurans CBS 112818] gi|326480270|gb|EGE04280.1| 60S ribosomal protein L43 [Trichophyton equinum CBS 127.97] gi|607897871|gb|EZF36173.1| 60S ribosomal protein L43 [Trichophyton interdigitale H6] Length = 92 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR+ VGIW+C++C KTVAGGAWTVST AAATTRSTIRRLRE+AEV Sbjct: 47 VKRTAVGIWECRSCRKTVAGGAWTVSTAAAATTRSTIRRLREIAEV 92 >ref|XP_003170511.1| 60S ribosomal protein L43 [Arthroderma gypseum CBS 118893] gi|311345545|gb|EFR04748.1| 60S ribosomal protein L43 [Arthroderma gypseum CBS 118893] Length = 92 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR+ VGIW+C++C KTVAGGAWTVST AAATTRSTIRRLRE+AEV Sbjct: 47 VKRAAVGIWECRSCRKTVAGGAWTVSTAAAATTRSTIRRLREIAEV 92 >ref|XP_002848386.1| 60S ribosomal protein L43 [Arthroderma otae CBS 113480] gi|327300122|ref|XP_003234754.1| 60S ribosomal protein L43 [Trichophyton rubrum CBS 118892] gi|238841411|gb|EEQ31073.1| 60S ribosomal protein L43 [Arthroderma otae CBS 113480] gi|326463648|gb|EGD89101.1| 60S ribosomal protein L37a [Trichophyton rubrum CBS 118892] gi|607878234|gb|EZF23305.1| 60S ribosomal protein L43 [Trichophyton rubrum MR850] gi|607904914|gb|EZF42276.1| 60S ribosomal protein L43 [Trichophyton rubrum CBS 100081] gi|607917018|gb|EZF52940.1| 60S ribosomal protein L43 [Trichophyton rubrum CBS 288.86] gi|607929103|gb|EZF63580.1| 60S ribosomal protein L43 [Trichophyton rubrum CBS 289.86] gi|607941164|gb|EZF74353.1| 60S ribosomal protein L43 [Trichophyton soudanense CBS 452.61] gi|607953066|gb|EZF84847.1| 60S ribosomal protein L43 [Trichophyton rubrum MR1448] gi|607965270|gb|EZF95609.1| 60S ribosomal protein L43 [Trichophyton rubrum MR1459] gi|607977573|gb|EZG06703.1| 60S ribosomal protein L43 [Trichophyton rubrum CBS 735.88] gi|607989237|gb|EZG17152.1| 60S ribosomal protein L43 [Trichophyton rubrum CBS 202.88] Length = 92 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR+ VGIW+C++C KTVAGGAWTVST AAATTRSTIRRLRE+AEV Sbjct: 47 VKRTAVGIWECRSCRKTVAGGAWTVSTAAAATTRSTIRRLREIAEV 92 >gb|EME84721.1| hypothetical protein MYCFIDRAFT_88568 [Pseudocercospora fijiensis CIRAD86] Length = 92 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR GIW+C+ACGKT+AGGA+TVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRQATGIWNCRACGKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_002836190.1| 60S ribosomal protein L43 [Tuber melanosporum Mel28] gi|295629998|emb|CAZ80381.1| unnamed protein product [Tuber melanosporum] Length = 92 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR++VGIW C++C KTVAGGAW VSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRTSVGIWKCRSCKKTVAGGAWVVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001935731.1| 60S ribosomal protein L43 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330906022|ref|XP_003295325.1| 60S ribosomal protein L43 [Pyrenophora teres f. teres 0-1] gi|187982830|gb|EDU48318.1| 60S ribosomal protein L37a [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311333483|gb|EFQ96582.1| hypothetical protein PTT_00414 [Pyrenophora teres f. teres 0-1] Length = 92 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIWDCK+CGK AGGA+TVSTPAAA TRSTIRRLRE+AEV Sbjct: 47 VKRRAVGIWDCKSCGKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001538929.1| 60S ribosomal protein L43 [Ajellomyces capsulatus NAm1] gi|150414002|gb|EDN09367.1| 60S ribosomal protein L43 [Ajellomyces capsulatus NAm1] gi|225555921|gb|EEH04211.1| 60S ribosomal protein L37A [Ajellomyces capsulatus G186AR] gi|240278586|gb|EER42092.1| ribosomal protein L37a [Ajellomyces capsulatus H143] gi|325090494|gb|EGC43804.1| ribosomal protein L37a [Ajellomyces capsulatus H88] Length = 92 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW+C++C K VAGGAWTVSTPAAAT RSTIRRLRE+AEV Sbjct: 47 VKRKAVGIWECRSCSKVVAGGAWTVSTPAAATIRSTIRRLREIAEV 92 >gb|ERT02009.1| ribosomal protein L37a [Sporothrix schenckii ATCC 58251] Length = 145 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR+NVGIW CKAC KT+AGGA+ VSTPAAA TRST+RRLRE+AEV Sbjct: 100 VKRTNVGIWQCKACKKTIAGGAYLVSTPAAAATRSTLRRLREIAEV 145 >emb|CCX12531.1| Similar to 60S ribosomal protein L43; acc. no. Q751L1 [Pyronema omphalodes CBS 100304] Length = 92 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +2 Query: 2 VKRSNVGIWDCKACGKTVAGGAWTVSTPAAATTRSTIRRLRELAEV 139 VKR VGIW+CK+C KTVAGGAWTVST AAA +RSTIRRLRELAEV Sbjct: 47 VKRKAVGIWECKSCSKTVAGGAWTVSTAAAAASRSTIRRLRELAEV 92