BLASTX nr result
ID: Akebia23_contig00059510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00059510 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006455315.1| hypothetical protein AGABI2DRAFT_209748 [Aga... 66 4e-09 ref|XP_007330841.1| hypothetical protein AGABI1DRAFT_60692 [Agar... 66 4e-09 ref|XP_001799602.1| hypothetical protein SNOG_09306 [Phaeosphaer... 56 5e-06 gb|ESK93413.1| carbohydrate esterase family 15 protein [Moniliop... 55 8e-06 >ref|XP_006455315.1| hypothetical protein AGABI2DRAFT_209748 [Agaricus bisporus var. bisporus H97] gi|426194119|gb|EKV44051.1| hypothetical protein AGABI2DRAFT_209748 [Agaricus bisporus var. bisporus H97] Length = 455 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 140 CPATPSGNTAANAKLPDPFTFADGTTKVTDQASFKCRQAEISKLLQ 3 CP TPS + +N LPDPFTFADG TKVT +A + CR+AE+SKLLQ Sbjct: 86 CPTTPSNLSFSNTFLPDPFTFADGQTKVTTKAQWNCRRAELSKLLQ 131 >ref|XP_007330841.1| hypothetical protein AGABI1DRAFT_60692 [Agaricus bisporus var. burnettii JB137-S8] gi|409078119|gb|EKM78483.1| hypothetical protein AGABI1DRAFT_60692 [Agaricus bisporus var. burnettii JB137-S8] Length = 455 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 140 CPATPSGNTAANAKLPDPFTFADGTTKVTDQASFKCRQAEISKLLQ 3 CP TPS + +N LPDPFTFADG TKVT +A + CR+AE+SKLLQ Sbjct: 86 CPTTPSNLSFSNTFLPDPFTFADGQTKVTTKAQWNCRRAELSKLLQ 131 >ref|XP_001799602.1| hypothetical protein SNOG_09306 [Phaeosphaeria nodorum SN15] gi|111062378|gb|EAT83498.1| hypothetical protein SNOG_09306 [Phaeosphaeria nodorum SN15] Length = 392 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 164 IFEERQ-AACPATPSG-NTAANAKLPDPFTFADGTTKVTDQASFKCRQAEISKLLQ 3 + EERQ AACPA PS +A NAKLP+PF F DGT VT +A F CR E+S +Q Sbjct: 19 VIEERQEAACPAIPSTFPSATNAKLPNPFKFFDGTA-VTTKAQFDCRNKEVSAAIQ 73 >gb|ESK93413.1| carbohydrate esterase family 15 protein [Moniliophthora roreri MCA 2997] Length = 400 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -3 Query: 143 ACPATPSGNTAA-NAKLPDPFTFADGTTKVTDQASFKCRQAEISKLLQ 3 ACPA PS T++ NAKLPDPFTFADG TKV + CR EIS+L+Q Sbjct: 32 ACPAIPSNPTSSSNAKLPDPFTFADG-TKVATLDDWTCRADEISQLIQ 78