BLASTX nr result
ID: Akebia23_contig00059265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00059265 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003303165.1| hypothetical protein PTT_15281 [Pyrenophora ... 96 4e-18 ref|XP_001792750.1| hypothetical protein SNOG_02132 [Phaeosphaer... 95 1e-17 ref|XP_001938620.1| hypothetical protein PTRG_08288 [Pyrenophora... 94 2e-17 gb|EMD58308.1| hypothetical protein COCSADRAFT_41976 [Bipolaris ... 93 4e-17 gb|EUC45919.1| hypothetical protein COCMIDRAFT_94292 [Bipolaris ... 92 6e-17 gb|EMD85444.1| hypothetical protein COCHEDRAFT_1024505 [Bipolari... 92 6e-17 gb|EUN24914.1| hypothetical protein COCVIDRAFT_104704 [Bipolaris... 92 1e-16 gb|EUC34520.1| hypothetical protein COCCADRAFT_93282 [Bipolaris ... 92 1e-16 ref|XP_003843227.1| similar to esterase/lipase/thioesterase [Lep... 92 1e-16 gb|EOA82991.1| hypothetical protein SETTUDRAFT_165342 [Setosphae... 90 3e-16 ref|XP_007586402.1| putative esterase lipase thioesterase protei... 77 3e-12 gb|EON64647.1| hypothetical protein W97_03880 [Coniosporium apol... 76 4e-12 gb|EMF11280.1| Abhydrolase_3-domain-containing protein [Sphaerul... 76 6e-12 gb|EKG20787.1| Alpha/beta hydrolase fold-3 [Macrophomina phaseol... 74 2e-11 gb|EME41239.1| hypothetical protein DOTSEDRAFT_73603 [Dothistrom... 72 8e-11 gb|EMC92611.1| hypothetical protein BAUCODRAFT_76924 [Baudoinia ... 71 2e-10 dbj|BAK04165.1| predicted protein [Hordeum vulgare subsp. vulgare] 71 2e-10 ref|XP_003854984.1| hypothetical protein MYCGRDRAFT_68502 [Zymos... 60 3e-07 gb|EPS38363.1| hypothetical protein H072_8041 [Dactylellina hapt... 59 9e-07 gb|EGX52071.1| hypothetical protein AOL_s00043g461 [Arthrobotrys... 59 9e-07 >ref|XP_003303165.1| hypothetical protein PTT_15281 [Pyrenophora teres f. teres 0-1] gi|311320962|gb|EFQ88718.1| hypothetical protein PTT_15281 [Pyrenophora teres f. teres 0-1] Length = 445 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +1 Query: 136 GNRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 GNRPRW+LHIQAQFWRVLMGIGMMLHRLARPLPP P+FHRDI+A+VS Sbjct: 11 GNRPRWMLHIQAQFWRVLMGIGMMLHRLARPLPPRPAFHRDIEASVS 57 >ref|XP_001792750.1| hypothetical protein SNOG_02132 [Phaeosphaeria nodorum SN15] gi|111069224|gb|EAT90344.1| hypothetical protein SNOG_02132 [Phaeosphaeria nodorum SN15] Length = 440 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 130 MPGNRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 MPG RPRWILH+QAQFWRVLMGIGMMLH+LARPLPP P+F +DIDAT+S Sbjct: 1 MPGARPRWILHVQAQFWRVLMGIGMMLHKLARPLPPRPAFTQDIDATIS 49 >ref|XP_001938620.1| hypothetical protein PTRG_08288 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985719|gb|EDU51207.1| hypothetical protein PTRG_08288 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 445 Score = 94.4 bits (233), Expect = 2e-17 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +1 Query: 136 GNRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 G+RPRWILHIQAQFWRVLMGIGMMLHRLARPLPP P+FHRDI+++VS Sbjct: 11 GSRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPRPAFHRDIESSVS 57 >gb|EMD58308.1| hypothetical protein COCSADRAFT_41976 [Bipolaris sorokiniana ND90Pr] Length = 454 Score = 92.8 bits (229), Expect = 4e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 +RPRWILHIQAQFWRVLMGIGM+LHRLARP PP P+FHRDIDATVS Sbjct: 15 SRPRWILHIQAQFWRVLMGIGMVLHRLARPWPPKPAFHRDIDATVS 60 >gb|EUC45919.1| hypothetical protein COCMIDRAFT_94292 [Bipolaris oryzae ATCC 44560] Length = 454 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 +RPRWILHIQAQFWRVLMGIGM+LHRLARP PP P+FHRDIDATVS Sbjct: 15 SRPRWILHIQAQFWRVLMGIGMVLHRLARPWPPRPAFHRDIDATVS 60 >gb|EMD85444.1| hypothetical protein COCHEDRAFT_1024505 [Bipolaris maydis C5] gi|477582343|gb|ENH99453.1| hypothetical protein COCC4DRAFT_34847 [Bipolaris maydis ATCC 48331] Length = 454 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 +RPRWILHIQAQFWRVLMGIGM+LHRLARP PP P+FHRDIDATVS Sbjct: 15 SRPRWILHIQAQFWRVLMGIGMVLHRLARPWPPRPAFHRDIDATVS 60 >gb|EUN24914.1| hypothetical protein COCVIDRAFT_104704 [Bipolaris victoriae FI3] Length = 454 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 +RPRWILHIQAQFWRVLMGIGM+LHRLARP PP P+FH+DIDATVS Sbjct: 15 SRPRWILHIQAQFWRVLMGIGMVLHRLARPWPPKPAFHKDIDATVS 60 >gb|EUC34520.1| hypothetical protein COCCADRAFT_93282 [Bipolaris zeicola 26-R-13] Length = 454 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 +RPRWILHIQAQFWRVLMGIGM+LHRLARP PP P+FH+DIDATVS Sbjct: 15 SRPRWILHIQAQFWRVLMGIGMVLHRLARPWPPKPAFHKDIDATVS 60 >ref|XP_003843227.1| similar to esterase/lipase/thioesterase [Leptosphaeria maculans JN3] gi|312219806|emb|CBX99748.1| similar to esterase/lipase/thioesterase [Leptosphaeria maculans JN3] Length = 463 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +1 Query: 133 PGNRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 PGNRPRW+LH+QAQ WR LMGIGMMLH+LARPLPP P+F+RDI+A+VS Sbjct: 12 PGNRPRWVLHVQAQIWRFLMGIGMMLHKLARPLPPRPAFYRDIEASVS 59 >gb|EOA82991.1| hypothetical protein SETTUDRAFT_165342 [Setosphaeria turcica Et28A] Length = 446 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 RPRW+LHIQAQFWRVLM IGM+LHRLARPLPP P+FHRDI+ATVS Sbjct: 15 RPRWVLHIQAQFWRVLMAIGMVLHRLARPLPPRPAFHRDIEATVS 59 >ref|XP_007586402.1| putative esterase lipase thioesterase protein [Neofusicoccum parvum UCRNP2] gi|485919956|gb|EOD46126.1| putative esterase lipase thioesterase protein [Neofusicoccum parvum UCRNP2] Length = 398 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 RPRW+LH+QAQFWRVLM IGM+LHRLARP PP P+F + + TVS Sbjct: 13 RPRWVLHVQAQFWRVLMSIGMILHRLARPRPPRPTFTKTVPTTVS 57 >gb|EON64647.1| hypothetical protein W97_03880 [Coniosporium apollinis CBS 100218] Length = 395 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 RPRW+LH+QAQFWR LMGIGMMLHR A P PP PSF R + T+S Sbjct: 3 RPRWMLHVQAQFWRTLMGIGMMLHRFAPPRPPKPSFTRTVTTTIS 47 >gb|EMF11280.1| Abhydrolase_3-domain-containing protein [Sphaerulina musiva SO2202] Length = 517 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 NRPRW+LH+QA FWRVLM +GM HR A P PP+PSF+R ID+TVS Sbjct: 59 NRPRWVLHLQATFWRVLMQLGMFFHRFAPPRPPNPSFYRMIDSTVS 104 >gb|EKG20787.1| Alpha/beta hydrolase fold-3 [Macrophomina phaseolina MS6] Length = 399 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 RPRW+LH+QAQFWR LM IGM LHRLA P PP PSF R + TVS Sbjct: 13 RPRWVLHVQAQFWRFLMEIGMFLHRLASPRPPKPSFTRTVTTTVS 57 >gb|EME41239.1| hypothetical protein DOTSEDRAFT_73603 [Dothistroma septosporum NZE10] Length = 548 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = +1 Query: 103 SENSSILQSMPGNRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 S+ ++I Q+ RPRW+LH+QAQ WR LM IGM+LHRLA P PP P+F+R + VS Sbjct: 59 SKKNAIYQTQ-SQRPRWVLHLQAQMWRFLMSIGMLLHRLAPPRPPKPNFYRSVPTHVS 115 >gb|EMC92611.1| hypothetical protein BAUCODRAFT_76924 [Baudoinia compniacensis UAMH 10762] Length = 422 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +1 Query: 106 ENSSILQSMPGNRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 E+ + Q RPRW+LH+QA WR LMG+GM+ H+LA P PP PSF R I T+S Sbjct: 5 ESRTAKQKAQAPRPRWVLHLQATMWRFLMGLGMLFHKLAPPRPPKPSFTRQIPTTIS 61 >dbj|BAK04165.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 598 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 RPRW+LH+QAQFWRVLMG+GM H++A P PP +F R I ATVS Sbjct: 145 RPRWVLHVQAQFWRVLMGLGMFFHKMAPPRPPKYNFVRTIPATVS 189 >ref|XP_003854984.1| hypothetical protein MYCGRDRAFT_68502 [Zymoseptoria tritici IPO323] gi|339474868|gb|EGP89960.1| hypothetical protein MYCGRDRAFT_68502 [Zymoseptoria tritici IPO323] Length = 428 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +1 Query: 139 NRPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 NRPRW+L +QA WR LM IGM LHRLA P P +FHR +T++ Sbjct: 49 NRPRWLLVLQAGLWRFLMSIGMFLHRLAPPRPKKANFHRTFTSTLA 94 >gb|EPS38363.1| hypothetical protein H072_8041 [Dactylellina haptotyla CBS 200.50] Length = 451 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 R RW LH++A WR LM IGM LH +A P PPSP+F R I +T+S Sbjct: 92 RSRWTLHLEAVTWRNLMSIGMYLHTVAHPRPPSPTFTRTIKSTLS 136 >gb|EGX52071.1| hypothetical protein AOL_s00043g461 [Arthrobotrys oligospora ATCC 24927] Length = 444 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 142 RPRWILHIQAQFWRVLMGIGMMLHRLARPLPPSPSFHRDIDATVS 276 R RW LH++A WR LM IGM LH +A P PPSP+F R I AT+S Sbjct: 85 RSRWSLHLEAVTWRNLMNIGMYLHTVALPRPPSPTFTRTIPATLS 129