BLASTX nr result
ID: Akebia23_contig00059255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00059255 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49751.1| hypothetical protein DOTSEDRAFT_68508 [Dothistrom... 112 5e-23 gb|EMD00531.1| hypothetical protein BAUCODRAFT_172695 [Baudoinia... 108 8e-22 gb|EME89421.1| hypothetical protein MYCFIDRAFT_55836 [Pseudocerc... 86 7e-15 gb|EMF17432.1| hypothetical protein SEPMUDRAFT_32096 [Sphaerulin... 85 9e-15 ref|XP_003856456.1| hypothetical protein MYCGRDRAFT_98637 [Zymos... 83 5e-14 ref|XP_001549642.1| hypothetical protein BC1G_11404 [Botryotinia... 70 4e-10 ref|XP_001587712.1| hypothetical protein SS1G_11705 [Sclerotinia... 69 5e-10 gb|ESZ89695.1| U1 snRNP splicing complex subunit (Luc7) [Sclerot... 68 2e-09 gb|EPE30139.1| hypothetical protein GLAREA_12862 [Glarea lozoyen... 67 2e-09 ref|XP_747514.1| conserved hypothetical protein [Aspergillus fum... 64 2e-08 ref|XP_001262256.1| hypothetical protein NFIA_099950 [Neosartory... 64 3e-08 gb|EDP48627.1| conserved hypothetical protein [Aspergillus fumig... 63 5e-08 gb|EHA21019.1| hypothetical protein ASPNIDRAFT_137513 [Aspergill... 62 6e-08 ref|XP_001390065.2| hypothetical protein ANI_1_1066034 [Aspergil... 62 6e-08 ref|XP_002481219.1| conserved hypothetical protein [Talaromyces ... 62 6e-08 emb|CAK38136.1| hypothetical protein An03g01630 [Aspergillus niger] 62 6e-08 gb|ERF75565.1| hypothetical protein EPUS_09442 [Endocarpon pusil... 62 1e-07 dbj|GAA86927.1| similar to An03g01630 [Aspergillus kawachii IFO ... 61 1e-07 ref|XP_664485.1| hypothetical protein AN6881.2 [Aspergillus nidu... 61 1e-07 ref|XP_001276780.1| conserved hypothetical protein [Aspergillus ... 61 2e-07 >gb|EME49751.1| hypothetical protein DOTSEDRAFT_68508 [Dothistroma septosporum NZE10] Length = 208 Score = 112 bits (280), Expect = 5e-23 Identities = 50/77 (64%), Positives = 63/77 (81%) Frame = +1 Query: 79 MADKLQQVGNQAQQSAGEGTKQWDAMTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQ 258 MAD+L+Q QAQ +AG GT++W+AMTE QKK T++SLP D+K+GK TY E I+ GY +Q Sbjct: 1 MADQLKQASAQAQSTAGAGTEKWNAMTEHQKKETYNSLPNDQKKGK-TYMEWISEGYQHQ 59 Query: 259 KENWMPWIEDQYLKWFT 309 KENWMPW+ED YLKWFT Sbjct: 60 KENWMPWVEDMYLKWFT 76 >gb|EMD00531.1| hypothetical protein BAUCODRAFT_172695 [Baudoinia compniacensis UAMH 10762] Length = 203 Score = 108 bits (270), Expect = 8e-22 Identities = 49/79 (62%), Positives = 61/79 (77%) Frame = +1 Query: 73 ATMADKLQQVGNQAQQSAGEGTKQWDAMTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYH 252 A + +Q N+AQQ A EGTK+W+AM+E+QKK TFD+LP ++K+GK TY E I GYH Sbjct: 2 AELQKTVQDTTNKAQQGASEGTKKWEAMSEEQKKHTFDNLPAEQKKGK-TYVEWIQEGYH 60 Query: 253 NQKENWMPWIEDQYLKWFT 309 +Q ENWMPWIED YLKWFT Sbjct: 61 HQYENWMPWIEDLYLKWFT 79 >gb|EME89421.1| hypothetical protein MYCFIDRAFT_55836 [Pseudocercospora fijiensis CIRAD86] Length = 184 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 154 MTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWFT 309 M+E+QKK TFD+LP++KKQGK TY E I GY +QKENWMPWIED YLKWFT Sbjct: 1 MSEEQKKQTFDALPEEKKQGK-TYTEWIKEGYQHQKENWMPWIEDLYLKWFT 51 >gb|EMF17432.1| hypothetical protein SEPMUDRAFT_32096 [Sphaerulina musiva SO2202] Length = 166 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/52 (71%), Positives = 46/52 (88%) Frame = +1 Query: 154 MTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWFT 309 M+EDQK+ TFD+LP++KKQGK +Y+E IA GY +QKENWMPWIED YL+WFT Sbjct: 1 MSEDQKQQTFDALPEEKKQGK-SYSEWIAEGYQHQKENWMPWIEDLYLRWFT 51 >ref|XP_003856456.1| hypothetical protein MYCGRDRAFT_98637 [Zymoseptoria tritici IPO323] gi|339476341|gb|EGP91432.1| hypothetical protein MYCGRDRAFT_98637 [Zymoseptoria tritici IPO323] Length = 170 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +1 Query: 154 MTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWFT 309 M+++QKKATF++LP+D+K+GK +Y E I GY NQ ENWMPWIEDQYLKWFT Sbjct: 1 MSDEQKKATFNALPEDQKRGK-SYMEWIKEGYQNQYENWMPWIEDQYLKWFT 51 >ref|XP_001549642.1| hypothetical protein BC1G_11404 [Botryotinia fuckeliana B05.10] gi|347440683|emb|CCD33604.1| hypothetical protein BofuT4_P072830.1 [Botryotinia fuckeliana T4] gi|472240360|gb|EMR85131.1| hypothetical protein BcDW1_6126 [Botryotinia fuckeliana BcDW1] Length = 195 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 T++QKK ++SL +D+KQ KQTY E + Y++Q E WMPWIEDQYLKWF Sbjct: 16 TDEQKKQFYESLSEDQKQ-KQTYTEWVKEAYNDQYEKWMPWIEDQYLKWF 64 >ref|XP_001587712.1| hypothetical protein SS1G_11705 [Sclerotinia sclerotiorum 1980] gi|154696088|gb|EDN95826.1| hypothetical protein SS1G_11705 [Sclerotinia sclerotiorum 1980 UF-70] Length = 200 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 T++QKK +D+L D+KQ KQTY E + Y++Q E WMPWIEDQYLKWF Sbjct: 16 TDEQKKQFYDNLSDDQKQ-KQTYTEWVKEAYNDQYEKWMPWIEDQYLKWF 64 >gb|ESZ89695.1| U1 snRNP splicing complex subunit (Luc7) [Sclerotinia borealis F-4157] Length = 476 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 T++QK+ +D+L D+KQ KQTY E + Y+ Q E WMPWIEDQYLKWF Sbjct: 296 TDEQKQKIYDNLSDDQKQ-KQTYTEWVKEAYNEQYEKWMPWIEDQYLKWF 344 >gb|EPE30139.1| hypothetical protein GLAREA_12862 [Glarea lozoyensis ATCC 20868] Length = 183 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TE+QKKA ++ LP+++K+ KQTY+E A Y Q E WMPWIEDQYL+WF Sbjct: 14 TEEQKKAAYNELPEEQKK-KQTYSEWAAQVYAVQYERWMPWIEDQYLRWF 62 >ref|XP_747514.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66845140|gb|EAL85476.1| conserved hypothetical protein [Aspergillus fumigatus Af293] Length = 189 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 T++QK+ +DSL +D+K+ KQT+ E + Y++Q E WMPW+E+QYLKWF Sbjct: 14 TDEQKRHFYDSLTEDQKK-KQTFGEWVKEAYNDQYEKWMPWLEEQYLKWF 62 >ref|XP_001262256.1| hypothetical protein NFIA_099950 [Neosartorya fischeri NRRL 181] gi|119410412|gb|EAW20359.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 189 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/50 (50%), Positives = 40/50 (80%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 T++QK+ +D+L +D+K+ KQT++E + Y++Q E WMPW+E+QYLKWF Sbjct: 14 TDEQKRHFYDNLTEDQKK-KQTFSEWVKEAYNDQYEKWMPWLEEQYLKWF 62 >gb|EDP48627.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 189 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 T++QK+ +DSL +D+K+ KQT+ E + Y+++ E WMPW+E+QYLKWF Sbjct: 14 TDEQKRHFYDSLTEDQKK-KQTFGEWVKEAYNDRYEKWMPWLEEQYLKWF 62 >gb|EHA21019.1| hypothetical protein ASPNIDRAFT_137513 [Aspergillus niger ATCC 1015] Length = 165 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TE++++ +DSLP +++ KQ++ E + Y+ Q E WMPW+EDQYLKWF Sbjct: 6 TEEEQRKLYDSLPAEQRN-KQSFTEWVKEAYNEQYEKWMPWLEDQYLKWF 54 >ref|XP_001390065.2| hypothetical protein ANI_1_1066034 [Aspergillus niger CBS 513.88] Length = 186 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TE++++ +DSLP +++ KQ++ E + Y+ Q E WMPW+EDQYLKWF Sbjct: 15 TEEEQRKLYDSLPAEQRN-KQSFTEWVKEAYNEQYEKWMPWLEDQYLKWF 63 >ref|XP_002481219.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218721366|gb|EED20785.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 184 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = +1 Query: 136 TKQWDAMTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TK TE+QK+ +++LP ++++ K +Y E + Y Q E WMPWIEDQYLKWF Sbjct: 8 TKSASEHTEEQKQHFYNNLPVNERENK-SYTEWVREAYQEQYEKWMPWIEDQYLKWF 63 >emb|CAK38136.1| hypothetical protein An03g01630 [Aspergillus niger] Length = 179 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TE++++ +DSLP +++ KQ++ E + Y+ Q E WMPW+EDQYLKWF Sbjct: 8 TEEEQRKLYDSLPAEQRN-KQSFTEWVKEAYNEQYEKWMPWLEDQYLKWF 56 >gb|ERF75565.1| hypothetical protein EPUS_09442 [Endocarpon pusillum Z07020] Length = 178 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 +E+QK+ ++ L ++KQ KQ+Y E + Y+NQ E WMPWIED+YL+WF Sbjct: 5 SEEQKREIYEGLSAEQKQ-KQSYTEWVKDAYNNQYEKWMPWIEDKYLEWF 53 >dbj|GAA86927.1| similar to An03g01630 [Aspergillus kawachii IFO 4308] Length = 186 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/50 (46%), Positives = 37/50 (74%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TE++++ +D+LP +++ KQ++ E + Y+ Q E WMPW+EDQYLKWF Sbjct: 15 TEEEQRKLYDNLPAEQRD-KQSFTEWVKEAYNEQYEKWMPWLEDQYLKWF 63 >ref|XP_664485.1| hypothetical protein AN6881.2 [Aspergillus nidulans FGSC A4] gi|40739090|gb|EAA58280.1| hypothetical protein AN6881.2 [Aspergillus nidulans FGSC A4] gi|259480481|tpe|CBF71653.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] Length = 190 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 2/68 (2%) Frame = +1 Query: 109 QAQQSAG--EGTKQWDAMTEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWI 282 Q+QQ A E + TE+QK+ + LP+ +++GK +YA+ + Y Q E WMPW+ Sbjct: 10 QSQQRAAPAEAGPSTPSHTEEQKRHFYGILPEQERKGK-SYAQWVREAYAEQYEKWMPWL 68 Query: 283 EDQYLKWF 306 EDQYL+WF Sbjct: 69 EDQYLRWF 76 >ref|XP_001276780.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119404992|gb|EAW15354.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 189 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/50 (48%), Positives = 38/50 (76%) Frame = +1 Query: 157 TEDQKKATFDSLPKDKKQGKQTYAEGIAAGYHNQKENWMPWIEDQYLKWF 306 TE+QK+ +D+L D+++ +Q+Y E + Y++Q E WMPW+E+QYLKWF Sbjct: 14 TEEQKRHFYDNLTDDQRK-QQSYTEWVKEAYNDQYEKWMPWLEEQYLKWF 62