BLASTX nr result
ID: Akebia23_contig00059180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00059180 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS74879.1| hypothetical protein PFICI_13363 [Pestalotiopsis ... 70 2e-10 gb|EQB53948.1| bZIP transcription factor [Colletotrichum gloeosp... 70 2e-10 ref|XP_007287850.1| bZIP transcription factor [Colletotrichum gl... 70 2e-10 emb|CAD21519.1| putative bZip transcription factor [Claviceps pu... 66 4e-09 emb|CCF43752.1| bZIP transcription factor [Colletotrichum higgin... 65 1e-08 gb|EON99898.1| putative bzip transcription factor protein [Togni... 64 2e-08 gb|EJT80735.1| BZIP transcription factor [Gaeumannomyces gramini... 63 4e-08 ref|XP_390318.1| hypothetical protein FG10142.1 [Fusarium gramin... 63 5e-08 gb|EPE05003.1| bzip transcription factor [Ophiostoma piceae UAMH... 63 5e-08 gb|EMR65087.1| putative bzip transcription factor protein [Eutyp... 63 5e-08 gb|EKJ77186.1| hypothetical protein FPSE_02636 [Fusarium pseudog... 63 5e-08 ref|XP_003715195.1| BZIP transcription factor [Magnaporthe oryza... 63 5e-08 gb|EXM32837.1| hypothetical protein FOTG_03037 [Fusarium oxyspor... 62 6e-08 gb|EXM32836.1| hypothetical protein FOTG_03037 [Fusarium oxyspor... 62 6e-08 gb|EXM32835.1| hypothetical protein FOTG_03037 [Fusarium oxyspor... 62 6e-08 gb|EXM01762.1| hypothetical protein FOIG_07262 [Fusarium oxyspor... 62 6e-08 gb|EXM01761.1| hypothetical protein FOIG_07262 [Fusarium oxyspor... 62 6e-08 gb|EXA44828.1| hypothetical protein FOVG_06123 [Fusarium oxyspor... 62 6e-08 gb|EXA44827.1| hypothetical protein FOVG_06123 [Fusarium oxyspor... 62 6e-08 gb|EWY90636.1| hypothetical protein FOYG_08078 [Fusarium oxyspor... 62 6e-08 >gb|ETS74879.1| hypothetical protein PFICI_13363 [Pestalotiopsis fici W106-1] Length = 506 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/60 (60%), Positives = 39/60 (65%) Frame = +1 Query: 55 SIAAPPSMNGXXXXXXXXXXXXXXXXXXGKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 ++ APPS +G KPKSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 354 AVPAPPSHDGEEEHTSEEDGGDHDDDDDSKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 413 >gb|EQB53948.1| bZIP transcription factor [Colletotrichum gloeosporioides Cg-14] Length = 536 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/61 (59%), Positives = 39/61 (63%) Frame = +1 Query: 52 TSIAAPPSMNGXXXXXXXXXXXXXXXXXXGKPKSKMTDEEKRKNFLERNRVAALKCRQRK 231 T+++ PP MNG G KSKMTDEEKRKNFLERNRVAALKCRQRK Sbjct: 382 TNLSPPPDMNGDESHSDDDDDMKKHDDKEGGSKSKMTDEEKRKNFLERNRVAALKCRQRK 441 Query: 232 K 234 K Sbjct: 442 K 442 >ref|XP_007287850.1| bZIP transcription factor [Colletotrichum gloeosporioides Nara gc5] gi|429847495|gb|ELA23096.1| bZIP transcription factor [Colletotrichum gloeosporioides Nara gc5] Length = 536 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/61 (59%), Positives = 39/61 (63%) Frame = +1 Query: 52 TSIAAPPSMNGXXXXXXXXXXXXXXXXXXGKPKSKMTDEEKRKNFLERNRVAALKCRQRK 231 T+++ PP MNG G KSKMTDEEKRKNFLERNRVAALKCRQRK Sbjct: 382 TNLSPPPDMNGDESHSDDDDDMKKHDDKEGGSKSKMTDEEKRKNFLERNRVAALKCRQRK 441 Query: 232 K 234 K Sbjct: 442 K 442 >emb|CAD21519.1| putative bZip transcription factor [Claviceps purpurea] gi|399165143|emb|CCE33955.1| related to transcription factor atf1+ [Claviceps purpurea 20.1] Length = 550 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/56 (60%), Positives = 35/56 (62%) Frame = +1 Query: 67 PPSMNGXXXXXXXXXXXXXXXXXXGKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 P +MNG G PK KMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 401 PETMNGSVNEEDSDDDDDDMMGEDGNPKVKMTDEEKRKNFLERNRVAALKCRQRKK 456 >emb|CCF43752.1| bZIP transcription factor [Colletotrichum higginsianum] Length = 538 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/58 (62%), Positives = 36/58 (62%) Frame = +1 Query: 61 AAPPSMNGXXXXXXXXXXXXXXXXXXGKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 A PP MNG G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 388 APPPDMNGDDSHSDDDDDMKHENGEGGS-KSKMTDEEKRKNFLERNRVAALKCRQRKK 444 >gb|EON99898.1| putative bzip transcription factor protein [Togninia minima UCRPA7] Length = 219 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 145 PKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 PKSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 97 PKSKMTDEEKRKNFLERNRVAALKCRQRKK 126 >gb|EJT80735.1| BZIP transcription factor [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 523 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 399 GNTKSKMTDEEKRKNFLERNRVAALKCRQRKK 430 >ref|XP_390318.1| hypothetical protein FG10142.1 [Fusarium graminearum PH-1] gi|558866736|gb|ESU16819.1| hypothetical protein FGSG_10142 [Fusarium graminearum PH-1] gi|596545730|gb|EYB25773.1| hypothetical protein FG05_10142 [Fusarium graminearum] Length = 526 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 402 GSGKSKMTDEEKRKNFLERNRVAALKCRQRKK 433 >gb|EPE05003.1| bzip transcription factor [Ophiostoma piceae UAMH 11346] Length = 555 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G+PK KMT+EEKRKNFLERNRVAALKCRQRKK Sbjct: 440 GQPKVKMTEEEKRKNFLERNRVAALKCRQRKK 471 >gb|EMR65087.1| putative bzip transcription factor protein [Eutypa lata UCREL1] Length = 323 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 197 GHSKSKMTDEEKRKNFLERNRVAALKCRQRKK 228 >gb|EKJ77186.1| hypothetical protein FPSE_02636 [Fusarium pseudograminearum CS3096] Length = 524 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 400 GSGKSKMTDEEKRKNFLERNRVAALKCRQRKK 431 >ref|XP_003715195.1| BZIP transcription factor [Magnaporthe oryzae 70-15] gi|351647528|gb|EHA55388.1| BZIP transcription factor [Magnaporthe oryzae 70-15] gi|440468020|gb|ELQ37205.1| BZIP transcription factor (AtfA) [Magnaporthe oryzae Y34] gi|440487514|gb|ELQ67298.1| BZIP transcription factor (AtfA) [Magnaporthe oryzae P131] Length = 526 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G PK K TDEEKRKNFLERNRVAALKCRQRKK Sbjct: 401 GNPKGKQTDEEKRKNFLERNRVAALKCRQRKK 432 >gb|EXM32837.1| hypothetical protein FOTG_03037 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 390 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 266 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 297 >gb|EXM32836.1| hypothetical protein FOTG_03037 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 510 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 386 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 417 >gb|EXM32835.1| hypothetical protein FOTG_03037 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 526 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 402 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 433 >gb|EXM01762.1| hypothetical protein FOIG_07262 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 390 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 266 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 297 >gb|EXM01761.1| hypothetical protein FOIG_07262 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 510 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 386 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 417 >gb|EXA44828.1| hypothetical protein FOVG_06123 [Fusarium oxysporum f. sp. pisi HDV247] gi|590063252|gb|EXK90776.1| hypothetical protein FOQG_06927 [Fusarium oxysporum f. sp. raphani 54005] gi|591452524|gb|EXL84818.1| hypothetical protein FOPG_02844 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 390 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 266 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 297 >gb|EXA44827.1| hypothetical protein FOVG_06123 [Fusarium oxysporum f. sp. pisi HDV247] gi|590063251|gb|EXK90775.1| hypothetical protein FOQG_06927 [Fusarium oxysporum f. sp. raphani 54005] gi|591452523|gb|EXL84817.1| hypothetical protein FOPG_02844 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 510 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 386 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 417 >gb|EWY90636.1| hypothetical protein FOYG_08078 [Fusarium oxysporum FOSC 3-a] gi|587690647|gb|EWZ37252.1| hypothetical protein FOZG_11040 [Fusarium oxysporum Fo47] gi|587718743|gb|EWZ90080.1| hypothetical protein FOWG_07866 [Fusarium oxysporum f. sp. lycopersici MN25] gi|590037433|gb|EXK39291.1| hypothetical protein FOMG_06649 [Fusarium oxysporum f. sp. melonis 26406] gi|591421584|gb|EXL56721.1| hypothetical protein FOCG_04222 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 389 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 139 GKPKSKMTDEEKRKNFLERNRVAALKCRQRKK 234 G KSKMTDEEKRKNFLERNRVAALKCRQRKK Sbjct: 265 GGSKSKMTDEEKRKNFLERNRVAALKCRQRKK 296